BYKdb

Annotate results for A0A0W7YJR0

A0A0W7YJR0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0W7YJR0
DOMAINcd52/232TSSIAGEGKSTNAANIGVVFSQEGKSVLIVDADMRKPTLHHTFYLDNILGLSSVLSRQSA
LQEVIQETFVEGVDIISSGPIPPNPTELLASETMTSLLAEVKNIYDIIILDAPPLLFLSD
AQILSNKCDGTLLIVNTGAVGQADVIKSKSILTVSKANILGVILNNYKIKGNTYEHYYGK
E
SITE-75/-77GKS
SITEWalker A'79/86LIVDADMR
SITEWalker B159/165IILDAPP
SITEY Cluster225/229YEHYY
SITEWalker A59/61GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFFKRKTKKIPMARKLITVSDMSSIPSEQYRTIRANIKFSQPNRDVKTILVTSSIAGEGKSTNAANIGVVFSQEGKSVLI
                                                   TSSIAGEGKSTNAANIGVVFSQEGKSVLI
                                                          GKS                 LI
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDADMRKPTLHHTFYLDNILGLSSVLSRQSALQEVIQETFVEGVDIISSGPIPPNPTELLASETMTSLLAEVKNIYDIII
VDADMRKPTLHHTFYLDNILGLSSVLSRQSALQEVIQETFVEGVDIISSGPIPPNPTELLASETMTSLLAEVKNIYDIII
VDADMR                                                                        II
       170       180       190       200       210       220       230  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
LDAPPLLFLSDAQILSNKCDGTLLIVNTGAVGQADVIKSKSILTVSKANILGVILNNYKIKGNTYEHYYGKE
LDAPPLLFLSDAQILSNKCDGTLLIVNTGAVGQADVIKSKSILTVSKANILGVILNNYKIKGNTYEHYYGKE
LDAPP                                                           YEHYY   
© 1998-2019