BYKdb

Annotate results for A0A0W8EDI5

A0A0W8EDI5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0W8EDI5
DOMAINtad26/265SSFDVATLLMVTRRSLPWMVLLIALGLTAAWLYLRYTQPVYQSASTLKIDQKTQSAVLGL
GGVGGSAEAQQNAKNLAGEVELIKSNLIYRKLQDSLNLNVSYFVEGTVLASELYNATPFR
IDYDPADQILYNRKFDIVFSDAKRFSLVSKAESGDVRVDGVFNQPLKIGNSFIVLKPTEQ
AIQPNIPYYFIIHDNSSVWSYIDQGLTVEIINPEANTIAISFKDHNPKKARDIVNKIDTL
DOMAINcd607/795TSTISGEGKTFVAVNLGGIIALSDQRVIIIDLDMRKPKVNLAFEAENTKGVSTILIERHT
VQECIQRTSIPTLDFISAGPTPPNPSELILHPQFDQMLEELKQQYDVVIIDTPPVGLVTD
GVLIMRKVDIPIYIVRAGYSKKTFLKNINKLVRGSGFNKLTTILNDAQAGGAYGYGYGYG
YGYGSGYGY
SITEWalker A614/616GKT
SITEWalker A'634/641IIIDLDMR
SITEWalker B714/720VIIDTPP
SITE-739/-745YIVRAGY
SITEY Cluster779/796YGYGYGYGYGYGSGYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAVNKEAELEELIRASGEETDDVAESSFDVATLLMVTRRSLPWMVLLIALGLTAAWLYLRYTQPVYQSASTLKIDQKTQS
                         SSFDVATLLMVTRRSLPWMVLLIALGLTAAWLYLRYTQPVYQSASTLKIDQKTQS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVLGLGGVGGSAEAQQNAKNLAGEVELIKSNLIYRKLQDSLNLNVSYFVEGTVLASELYNATPFRIDYDPADQILYNRKF
AVLGLGGVGGSAEAQQNAKNLAGEVELIKSNLIYRKLQDSLNLNVSYFVEGTVLASELYNATPFRIDYDPADQILYNRKF

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DIVFSDAKRFSLVSKAESGDVRVDGVFNQPLKIGNSFIVLKPTEQAIQPNIPYYFIIHDNSSVWSYIDQGLTVEIINPEA
DIVFSDAKRFSLVSKAESGDVRVDGVFNQPLKIGNSFIVLKPTEQAIQPNIPYYFIIHDNSSVWSYIDQGLTVEIINPEA

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NTIAISFKDHNPKKARDIVNKIDTLYLQEKLAKNTQATQQALAFLEGQLDQNSQRLQGAEEALQEFVKRNKTYDVKSDLA
NTIAISFKDHNPKKARDIVNKIDTL                                                       

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TITEKMEALEEEKEQLLRKAGAIGEIAQLVEQNQVMVQEGDDIEQSIPALAILEDAQLTQQIGVLNDQQADMNRLLESYK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PTTTAVQIRREQLDFTRRSIRRLLQQASQLVRSEVSKLNQQQRELEGRLQLLPEKETELVRLRRPFDLYEKTYLMLMDKK


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VEFSIQKAGTTPDFQILSPATLPTAPIFPVRTMVYAIGLAAGVALGLGLVAVRFFLHNTITTVRELESNTVAPVLGVVPS


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YDKEKLTVSKLIVDKNPKSAISEAIRSIRTNLEFLAPSKHKRLISITSTISGEGKTFVAVNLGGIIALSDQRVIIIDLDM
                                              TSTISGEGKTFVAVNLGGIIALSDQRVIIIDLDM
                                                     GKT                 IIIDLDM
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKPKVNLAFEAENTKGVSTILIERHTVQECIQRTSIPTLDFISAGPTPPNPSELILHPQFDQMLEELKQQYDVVIIDTPP
RKPKVNLAFEAENTKGVSTILIERHTVQECIQRTSIPTLDFISAGPTPPNPSELILHPQFDQMLEELKQQYDVVIIDTPP
R                                                                        VIIDTPP
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VGLVTDGVLIMRKVDIPIYIVRAGYSKKTFLKNINKLVRGSGFNKLTTILNDAQAGGAYGYGYGYGYGYGSGYGYYEDEP
VGLVTDGVLIMRKVDIPIYIVRAGYSKKTFLKNINKLVRGSGFNKLTTILNDAQAGGAYGYGYGYGYGYGSGYGY     
                                                          YGYGYGYGYGYGSGYGYY    
       810    
....:....|....
APKGLFGQLRRRFS


© 1998-2019