BYKdb

Annotate results for A0A0W8FS74

A0A0W8FS74 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0W8FS74
DOMAINtad18/236ENAHIYDYLSVILRRRKLFTLAFCAVLFSVVLYTYFMKPIYEASSTLHIKKEKGPGVLVD
MNFDSSNSIDAELEIIKSRTNLEHVAKRLHLDWQVTKKSKDLDFKLLDFSSTAKNPSYKI
EMTGADTFTVKDEDGKLIGEGISGRLMQAKGFSLLLNDLKGEKGDSFRLKLLPLQNIAVS
LKGGFKATEVGNRTNIVRISYSSTDPVRARDLVNTLVQV
DOMAINcd576/765TSTFPGEGKSIITANLSNTMAQTGVKVLVVDCDLRRSSLHDKFGVNKVPGLSEVLTGDTT
FREVLHDTGIPGIDVITAGTTPPNPAELLGSEAMRQFLITHRDEYDHIFIDAPPVLAVTD
APVLTTMSDIVLLIMEAGRVPIKAAQHMREMLSNVQAPVAGFVLNDKTGSGETYGYYGSR
YYRYGRYGKG
SITEWalker A583/585GKS
SITEWalker A'603/610LVVDCDLR
SITEWalker B683/689IFIDAPP
SITEY Cluster749/774YGYYGSRYYRYGRYGKGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTPNVSIPPSQPLLRSGENAHIYDYLSVILRRRKLFTLAFCAVLFSVVLYTYFMKPIYEASSTLHIKKEKGPGVLVDMNF
                 ENAHIYDYLSVILRRRKLFTLAFCAVLFSVVLYTYFMKPIYEASSTLHIKKEKGPGVLVDMNF

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSSNSIDAELEIIKSRTNLEHVAKRLHLDWQVTKKSKDLDFKLLDFSSTAKNPSYKIEMTGADTFTVKDEDGKLIGEGIS
DSSNSIDAELEIIKSRTNLEHVAKRLHLDWQVTKKSKDLDFKLLDFSSTAKNPSYKIEMTGADTFTVKDEDGKLIGEGIS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GRLMQAKGFSLLLNDLKGEKGDSFRLKLLPLQNIAVSLKGGFKATEVGNRTNIVRISYSSTDPVRARDLVNTLVQVYLGQ
GRLMQAKGFSLLLNDLKGEKGDSFRLKLLPLQNIAVSLKGGFKATEVGNRTNIVRISYSSTDPVRARDLVNTLVQV    

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NIELKTEEASRTVSFIENQLKGLRGELEGAEQDLETYKSSSGMFKLDSEAQEVVKNLSETEKLRAEVIFQKKQVEFALDA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LNSALRKGNIYSPAIMRDDPLVAGLAAKLSELEIQKRTLLTDYTENHPAVRTIQGQIDEIQKKIRSTYETNLVNLNKQQS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVTHQLDIYESKLRKLPKAERDLARLTRVSNVNAGIYTFLLQKHEEARIAKATTVSNINIVDPAITPVSPIKPDKPKNLL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGFLVACILGIGLAFFQEYLDDTIKDAEEAKRAIGLPLLAVIPFITSRAENGEAKKRLPLITRLEPKSQVAEAFRSLRTS


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LHFSAINRDKKIILITSTFPGEGKSIITANLSNTMAQTGVKVLVVDCDLRRSSLHDKFGVNKVPGLSEVLTGDTTFREVL
               TSTFPGEGKSIITANLSNTMAQTGVKVLVVDCDLRRSSLHDKFGVNKVPGLSEVLTGDTTFREVL
                      GKS                 LVVDCDLR                              
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HDTGIPGIDVITAGTTPPNPAELLGSEAMRQFLITHRDEYDHIFIDAPPVLAVTDAPVLTTMSDIVLLIMEAGRVPIKAA
HDTGIPGIDVITAGTTPPNPAELLGSEAMRQFLITHRDEYDHIFIDAPPVLAVTDAPVLTTMSDIVLLIMEAGRVPIKAA
                                          IFIDAPP                               
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QHMREMLSNVQAPVAGFVLNDKTGSGETYGYYGSRYYRYGRYGKGYGYGYGYGYGYYSDDEPNRCKNPQRWEKVLNFIPE
QHMREMLSNVQAPVAGFVLNDKTGSGETYGYYGSRYYRYGRYGKG                                   
                            YGYYGSRYYRYGRYGKGYGYGYGYGY                          
       810  
....:....|..
KLRKEIKKRFKF


© 1998-2019