BYKdb

Annotate results for A0A0W8FVN7

A0A0W8FVN7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0W8FVN7
DOMAINcd216/403TSSSAGEGKTTTAVNLAGSFAQANQKVLLLDCDLRKPRVHKIFNDERYPGFIDYFFGQAT
FDELIRKTEQANLFYITGGTIPPNPAEILGSHKMEEFLAKLETHFDLIVIDSPPIIAVTD
SEILSQIVDGVMLVISAGVTEYDILYKSLDVLKMAKSQFLGAVLNKFAYRPGYGSYYKYY
YYYYNTGN
SITEWalker A223/225GKT
SITEWalker A'243/250LLLDCDLR
SITEWalker B323/329IVIDSPP
SITE-263/-269YPGFIDY
SITE-357/-361YDILY
SITEY Cluster384/399YRPGYGSYYKYYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNEQILVYKAGIFASNPAQIQQLTAKVLEEEVRYQSLLSSHKELDELVQRYEVRFNEMPKRTLDLARLQRIKEANEKLYL


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVEEKYQEAQINEQSTPGNVLIIDAARQPENPSKPNRILIIAVGLVLGLGFGFGFAFVRNYFDNTVKTPEELQQKNISLL


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AWIPEMFVADKNRAPGSEFIVNKKSDSTASEAYRALRTRIRYSGVEGTIPKKLLVTSSSAGEGKTTTAVNLAGSFAQANQ
                                                       TSSSAGEGKTTTAVNLAGSFAQANQ
                                                              GKT               
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KVLLLDCDLRKPRVHKIFNDERYPGFIDYFFGQATFDELIRKTEQANLFYITGGTIPPNPAEILGSHKMEEFLAKLETHF
KVLLLDCDLRKPRVHKIFNDERYPGFIDYFFGQATFDELIRKTEQANLFYITGGTIPPNPAEILGSHKMEEFLAKLETHF
  LLLDCDLR                                                                      
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLIVIDSPPIIAVTDSEILSQIVDGVMLVISAGVTEYDILYKSLDVLKMAKSQFLGAVLNKFAYRPGYGSYYKYYYYYYN
DLIVIDSPPIIAVTDSEILSQIVDGVMLVISAGVTEYDILYKSLDVLKMAKSQFLGAVLNKFAYRPGYGSYYKYYYYYYN
  IVIDSPP                                                      YRPGYGSYYKYYYYYY 
       410    
....:....|....
TGNGKEDKKKLLKV
TGN           

© 1998-2019