BYKdb

Annotate results for A0A0W8I9Y2

A0A0W8I9Y2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0W8I9Y2
DOMAINcd86/276TSALPGEGKSSITANLAVAIASTGRNVVVVDGDLRRPVITDLFGLVPGVGVTDVLTGQVQ
VDEVLQTYDKFPNLQVLGAGRTAPNPTELLSSKAMHAMLETLAEDALVLVDAPPLLPVTD
AALLTASADGAIIVATAQKTTTDELSKALENLHQVHGNVLGVVLNRVPTTGADAGYYGYY
GKSYYANSDDQ
SITE-266/-268GKS
SITEWalker A'113/120VVVDGDLR
SITEWalker B193/199VLVDAPP
SITEY Cluster261/270YYGYYGKSYY
SITEWalker A93/95GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGLLYAFARFKMDRRIKSVEEIRDGFGVAVLGVIPTDDRLADHREIVETGFSAGRGHHEFSEALRELRTNLSFVSVDSPP


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KMIVVTSALPGEGKSSITANLAVAIASTGRNVVVVDGDLRRPVITDLFGLVPGVGVTDVLTGQVQVDEVLQTYDKFPNLQ
     TSALPGEGKSSITANLAVAIASTGRNVVVVDGDLRRPVITDLFGLVPGVGVTDVLTGQVQVDEVLQTYDKFPNLQ
            GKS                 VVVDGDLR                                        
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLGAGRTAPNPTELLSSKAMHAMLETLAEDALVLVDAPPLLPVTDAALLTASADGAIIVATAQKTTTDELSKALENLHQV
VLGAGRTAPNPTELLSSKAMHAMLETLAEDALVLVDAPPLLPVTDAALLTASADGAIIVATAQKTTTDELSKALENLHQV
                                VLVDAPP                                         
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HGNVLGVVLNRVPTTGADAGYYGYYGKSYYANSDDQPAPKTGAQPVVAAPAAKQPWGTAPRAESSDAHQPAGASTRQEPT
HGNVLGVVLNRVPTTGADAGYYGYYGKSYYANSDDQ                                            
                    YYGYYGKSYY                                                  
       330       340       350       360      
....:....|....:....|....:....|....:....|....:.
VPSAEDAAPAPRAERSNGQGSAEHESFGLEAWGRSGSSTGSTAQGH


© 1998-2019