BYKdb

Annotate results for A0A0X1TJ17

A0A0X1TJ17 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0X1TJ17
DOMAINcd41/227TSSGPSEGKTTTSCNLAETFAQSGKRVLLIDGDLRKPRVHKVFKISGTKGLTNLLAGQLS
LEEVTSYVGSDLTVIPCGPIPPNPSELIASNRMKELVANLRQQYDMVIIDAPPVGVVTDS
AILSTIVDGTLLVVASGKTEIDGAKRAKQLLENVNARILGVVMTMIPVTKKGYYGYQYYS
YEEEVQT
SITE-177/-179GKT
SITEWalker A'68/75LLIDGDLR
SITEWalker B147/153VIIDAPP
SITEY Cluster213/221YYGYQYYSY
SITEWalker A48/50GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSSELITITNPKSPIAEAYRTLRTNIQFSNVDEDLKVICVTSSGPSEGKTTTSCNLAETFAQSGKRVLLIDGDLRKPRVH
                                        TSSGPSEGKTTTSCNLAETFAQSGKRVLLIDGDLRKPRVH
                                               GKT                 LLIDGDLR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KVFKISGTKGLTNLLAGQLSLEEVTSYVGSDLTVIPCGPIPPNPSELIASNRMKELVANLRQQYDMVIIDAPPVGVVTDS
KVFKISGTKGLTNLLAGQLSLEEVTSYVGSDLTVIPCGPIPPNPSELIASNRMKELVANLRQQYDMVIIDAPPVGVVTDS
                                                                  VIIDAPP       
       170       180       190       200       210       220       230        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
AILSTIVDGTLLVVASGKTEIDGAKRAKQLLENVNARILGVVMTMIPVTKKGYYGYQYYSYEEEVQTTRRKRSFFSKK
AILSTIVDGTLLVVASGKTEIDGAKRAKQLLENVNARILGVVMTMIPVTKKGYYGYQYYSYEEEVQT           
                                                    YYGYQYYSY                 
© 1998-2019