BYKdb

Annotate results for A0A0X8CM98

A0A0X8CM98 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0X8CM98
DOMAINtad22/197PSQTLTSYLDIIRRQFPTMVAIVSACVILALLYLFTAAPLFTSTASMVIDTRKVQLFQQQ
SVLGDISIDSATVETQVEILKSENISLAVIRDQHLIDDPEFTGAGGGLLGTVIGAISSLF
SDGKALSEFELTRKALERFERNRTIKRLGLTYVMEIGFTSKDPAKAARIANAIADA
DOMAINcd553/744TSTLPNEGKSTLSTNLAQLMAHGGARVILVDADLRNPSLSRALVPDAKIGLVDVVAQKVK
LEDAVVIDPDTKLSILPAGITSKLLHTNEILASKAMHALVTQLRSRFDYVVLDMPPMAPV
VDVRVTTSYVDSYVFVVEWGKTKTDVVQHNLRNAIEIQDKLLGVVLNKADTKVLARYESY
HGRYYYQKYYAR
SITEWalker A560/562GKS
SITEWalker A'580/587ILVDADLR
SITEWalker B662/668VVLDMPP
SITE-681/-685YVDSY
SITE-692/-694GKT
SITE-681/-738YVDSYVFVVEWGKTKTDVVQHNLRNAIEIQDKLLGVVLNKADTKVLARYESYHGRYYY
SITE-736/-747YYYQKYYARYGY
SITEY Cluster729/747YESYHGRYYYQKYYARYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLQVNKPTSEINRDFTEADGSPSQTLTSYLDIIRRQFPTMVAIVSACVILALLYLFTAAPLFTSTASMVIDTRKVQLFQQ
                     PSQTLTSYLDIIRRQFPTMVAIVSACVILALLYLFTAAPLFTSTASMVIDTRKVQLFQQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QSVLGDISIDSATVETQVEILKSENISLAVIRDQHLIDDPEFTGAGGGLLGTVIGAISSLFSDGKALSEFELTRKALERF
QSVLGDISIDSATVETQVEILKSENISLAVIRDQHLIDDPEFTGAGGGLLGTVIGAISSLFSDGKALSEFELTRKALERF

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ERNRTIKRLGLTYVMEIGFTSKDPAKAARIANAIADAYIVDSLEAKYQATRRASVWLQDRIKELRTQASAAQKAVVDFKT
ERNRTIKRLGLTYVMEIGFTSKDPAKAARIANAIADA                                           

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ANNIVDTGGRLMNEQQLAEVNSQLIMAHAATAEAKARLDRMNDILKQDIPDANVADALKNETIVKLRAQYVDLASKESIW


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STKYGHDHLAALNLRNQMAEIKRNITAELKRIQESYKSDYDIAVTREEAIKSSLANVVSESQLTNQAQVQLRELESNAQS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YQAMYDNFLQRYMESVQQQSFPITEARVISAATTPLLKSHPKTMIILAAALLGGLMLSFGAAMARELSDNVFRTTGQVEE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLGANCIAILPALGAPSTGFGARRAKSENAPQPDLLRYVVNNPLSRFSEAVRSLKVAVDLNSIVRENRVLAATSTLPNEG
                                                                        TSTLPNEG
                                                                               G
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KSTLSTNLAQLMAHGGARVILVDADLRNPSLSRALVPDAKIGLVDVVAQKVKLEDAVVIDPDTKLSILPAGITSKLLHTN
KSTLSTNLAQLMAHGGARVILVDADLRNPSLSRALVPDAKIGLVDVVAQKVKLEDAVVIDPDTKLSILPAGITSKLLHTN
KS                 ILVDADLR                                                     
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EILASKAMHALVTQLRSRFDYVVLDMPPMAPVVDVRVTTSYVDSYVFVVEWGKTKTDVVQHNLRNAIEIQDKLLGVVLNK
EILASKAMHALVTQLRSRFDYVVLDMPPMAPVVDVRVTTSYVDSYVFVVEWGKTKTDVVQHNLRNAIEIQDKLLGVVLNK
                     VVLDMPP                                                    
       730       740         
....:....|....:....|....:....
ADTKVLARYESYHGRYYYQKYYARYGYVE
ADTKVLARYESYHGRYYYQKYYAR     
        YESYHGRYYYQKYYARYGY  

© 1998-2019