BYKdb

Annotate results for A0A0X8GYC0

A0A0X8GYC0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0X8GYC0
DOMAINcd53/243TSSVPNEGKSTVSINVARTLSMAGHKVLLIDADLRAPVIQKYLNVNYKITSGLSSVLASK
AQIKDAIYKSPSLEMDVIFSGPIPPNAVELLSRDRAKTSIETLRKRYDYIIIDSPPAGVV
TDSVVLSQHVDGVLYVVRQNHAEKELVKNAMKDLVSMEANILGIIFNDYIDERSKRKGSR
DKYSYYYQSGN
SITEWalker A60/62GKS
SITEWalker A'80/87LLIDADLR
SITEWalker B162/168IIIDSPP
SITE-94/-99YLNVNY
SITE-159/-161YDY
SITEY Cluster235/239YSYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MISFKKRNKQVKKNKTYILSNKSPFAYLEGYKSLRTNLSFLTFSGEVKTILVTSSVPNEGKSTVSINVARTLSMAGHKVL
                                                    TSSVPNEGKSTVSINVARTLSMAGHKVL
                                                           GKS                 L
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LIDADLRAPVIQKYLNVNYKITSGLSSVLASKAQIKDAIYKSPSLEMDVIFSGPIPPNAVELLSRDRAKTSIETLRKRYD
LIDADLRAPVIQKYLNVNYKITSGLSSVLASKAQIKDAIYKSPSLEMDVIFSGPIPPNAVELLSRDRAKTSIETLRKRYD
LIDADLR                                                                         
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YIIIDSPPAGVVTDSVVLSQHVDGVLYVVRQNHAEKELVKNAMKDLVSMEANILGIIFNDYIDERSKRKGSRDKYSYYYQ
YIIIDSPPAGVVTDSVVLSQHVDGVLYVVRQNHAEKELVKNAMKDLVSMEANILGIIFNDYIDERSKRKGSRDKYSYYYQ
 IIIDSPP                                                                  YSYYY 
    
....
SGNK
SGN 

© 1998-2019