BYKdb

Annotate results for A0A0X8H0Y4

A0A0X8H0Y4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0X8H0Y4
DOMAINcd53/243SSSLPGEGKSSVSVNLARSLSMAGKKVLLIDADLRSPSVHKYLRIRKKVQDGFSTVLAGR
TKLEDAIYMFPPLEIDVMLSGSIPPNASELLSREHTGEIMSELKEKYDVVIIDTPPAGVV
TDAVVLSRYVDGLLFIVKQNYAEIDLIKHALKSFEQTGTKVLGVVMSDYKSTKDTRGSGS
YAYDYTYGVDS
SITEWalker A60/62GKS
SITEWalker A'80/87LLIDADLR
SITEWalker B162/168VIIDTPP
SITEY Cluster233/239YAYDYTY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFRKKAMLSASNHNKIDILDDNSSFSFVEGYRSLRTNLSFMTYSGDVKTILVSSSLPGEGKSSVSVNLARSLSMAGKKVL
                                                    SSSLPGEGKSSVSVNLARSLSMAGKKVL
                                                           GKS                 L
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LIDADLRSPSVHKYLRIRKKVQDGFSTVLAGRTKLEDAIYMFPPLEIDVMLSGSIPPNASELLSREHTGEIMSELKEKYD
LIDADLRSPSVHKYLRIRKKVQDGFSTVLAGRTKLEDAIYMFPPLEIDVMLSGSIPPNASELLSREHTGEIMSELKEKYD
LIDADLR                                                                         
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVIIDTPPAGVVTDAVVLSRYVDGLLFIVKQNYAEIDLIKHALKSFEQTGTKVLGVVMSDYKSTKDTRGSGSYAYDYTYG
VVIIDTPPAGVVTDAVVLSRYVDGLLFIVKQNYAEIDLIKHALKSFEQTGTKVLGVVMSDYKSTKDTRGSGSYAYDYTYG
 VIIDTPP                                                                YAYDYTY 
    
....
VDSK
VDS 

© 1998-2019