BYKdb

Annotate results for A0A0X8H118

A0A0X8H118 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0X8H118
DOMAINcd53/245TSALMGDGKSSVSINLARIMSMSGKKVLLIDGDMRSPSIHKYLKIRSKVKEGFSSVIAGR
TTVNEAIYSFPALEIDVMLSGPIPPNASELLSHEHTKKVLDELRGKYDMVIVDTPPAGIV
TDAVVLSNYVDGVLFVVKQNYAEKEVVKGTLKAFSGTESKILGVVMNDYSISKNLSRYRS
YEYRYGYGYGYGY
SITEWalker A60/62GKS
SITEWalker A'80/87LLIDGDMR
SITEWalker B162/168VIVDTPP
SITEY Cluster230/247YRSYEYRYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSKKKRKSSRVHPTQTDIIDPKSPFQFIEGYRSLRTNLGFTTFNGEVKTILVTSALMGDGKSSVSINLARIMSMSGKKVL
                                                    TSALMGDGKSSVSINLARIMSMSGKKVL
                                                           GKS                 L
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LIDGDMRSPSIHKYLKIRSKVKEGFSSVIAGRTTVNEAIYSFPALEIDVMLSGPIPPNASELLSHEHTKKVLDELRGKYD
LIDGDMRSPSIHKYLKIRSKVKEGFSSVIAGRTTVNEAIYSFPALEIDVMLSGPIPPNASELLSHEHTKKVLDELRGKYD
LIDGDMR                                                                         
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVIVDTPPAGIVTDAVVLSNYVDGVLFVVKQNYAEKEVVKGTLKAFSGTESKILGVVMNDYSISKNLSRYRSYEYRYGYG
MVIVDTPPAGIVTDAVVLSNYVDGVLFVVKQNYAEKEVVKGTLKAFSGTESKILGVVMNDYSISKNLSRYRSYEYRYGYG
 VIVDTPP                                                             YRSYEYRYGYG
       250       
....:....|....:..
YGYGYGYGHGAGDDSEQ
YGYGY            
YGYGYGY          
© 1998-2019