BYKdb

Annotate results for A0A0X8HCB3

A0A0X8HCB3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0X8HCB3
DOMAINtad13/266ETIDLGRMFGVLIDHKWLIIFVTGLFAVVGFVHGMLATPIYQSDALVQVERRSSVSPLGD
VGNIIGTESLNTPAELQILQSRMVLGQVVDWLGQDIIIRPVELPVIGNFVLRRNIPRPGF
MDGQPHIWGNESIDVPRFELSDRRRGQQILVERILDDRYRVLVNGEAVGNGRIGQPEIFL
DGDLELTIDGFDAAVGARFQLLKRHRNSAIRSIGSRLQVVEAGGRGTPTGMLRMTMVGPD
TQEITRTLDAVAET
DOMAINcd547/732TGPSPGVGKSFVSINLGAVSAQAGKRVLIVDADLRKGHIHHAFGKASENGLADYLAGQIP
LEEIIQPTGMENYWLITRGTAPPNPSELLMQPRFAIAMEELSQQFDLIIVDTPPVLAVTD
ASVVGKQCDTTLLVARFETNPVREIMAAKRRLEGNGLVVQGAILNAMERKASTASGHYGY
YFYNYR
SITEWalker A554/556GKS
SITEWalker A'574/581LIVDADLR
SITEWalker B654/660IIVDTPP
SITEY Cluster724/731YGYYFYNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSDKQVTQAPAEETIDLGRMFGVLIDHKWLIIFVTGLFAVVGFVHGMLATPIYQSDALVQVERRSSVSPLGDVGNIIGTE
            ETIDLGRMFGVLIDHKWLIIFVTGLFAVVGFVHGMLATPIYQSDALVQVERRSSVSPLGDVGNIIGTE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLNTPAELQILQSRMVLGQVVDWLGQDIIIRPVELPVIGNFVLRRNIPRPGFMDGQPHIWGNESIDVPRFELSDRRRGQQ
SLNTPAELQILQSRMVLGQVVDWLGQDIIIRPVELPVIGNFVLRRNIPRPGFMDGQPHIWGNESIDVPRFELSDRRRGQQ

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILVERILDDRYRVLVNGEAVGNGRIGQPEIFLDGDLELTIDGFDAAVGARFQLLKRHRNSAIRSIGSRLQVVEAGGRGTP
ILVERILDDRYRVLVNGEAVGNGRIGQPEIFLDGDLELTIDGFDAAVGARFQLLKRHRNSAIRSIGSRLQVVEAGGRGTP

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TGMLRMTMVGPDTQEITRTLDAVAETFLTQNVERQSAQAQQSLEFLEQQAPELREQLVSAEQNLNEYRANLDSVDLSSEA
TGMLRMTMVGPDTQEITRTLDAVAET                                                      

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QAAIQRYIELDTRLNELEFQEAELAQRYTPSHPSYQALLRQKSQIEQDRAELNARVNELPAAQQEVVRRTRDVEVTQAIY


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VNVLNKMQELQVARAGTIGNIRIIDRAEISGQVSPNRARTTILATLLGLILAIGVVLLRELLRRGVDSPEQIESAGLPVY


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATIPLSSAQNKLARRVKRKRRKPAQDIVVGVLAEREPSDLALEALRGLRTSLHFAMLEGRNNRLMITGPSPGVGKSFVSI
                                                                  TGPSPGVGKSFVSI
                                                                         GKS    
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLGAVSAQAGKRVLIVDADLRKGHIHHAFGKASENGLADYLAGQIPLEEIIQPTGMENYWLITRGTAPPNPSELLMQPRF
NLGAVSAQAGKRVLIVDADLRKGHIHHAFGKASENGLADYLAGQIPLEEIIQPTGMENYWLITRGTAPPNPSELLMQPRF
             LIVDADLR                                                           
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AIAMEELSQQFDLIIVDTPPVLAVTDASVVGKQCDTTLLVARFETNPVREIMAAKRRLEGNGLVVQGAILNAMERKASTA
AIAMEELSQQFDLIIVDTPPVLAVTDASVVGKQCDTTLLVARFETNPVREIMAAKRRLEGNGLVVQGAILNAMERKASTA
             IIVDTPP                                                            
       730  
....:....|..
SGHYGYYFYNYR
SGHYGYYFYNYR
   YGYYFYNY 

© 1998-2019