BYKdb

Annotate results for A0A0X8KK58

A0A0X8KK58 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0X8KK58
DOMAINcd34/213TSAGPEEGKSTTAANLAVVFAQQGKKVLLIDADLRKPTVHFTFKLDNGTGLTSLLLKQIP
FQKAVLRAEEANLDILTSGPIPPNPAELLSTGAMRDLLSEAALVYDKVILDTPPVLAVAD
TKILGSYTDGAIMVISSGKTDKEKAAKAKEALDYCPCKLLGAVMNGKKQTKHSDYAYYGQ
SITE-171/-173GKT
SITEWalker A'61/68LLIDADLR
SITEWalker B141/147VILDTPP
SITEY Cluster208/211YAYY
SITEWalker A41/43GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSEPKSINSEQYRTIRTNIEFSSVDTEVKSLLITSAGPEEGKSTTAANLAVVFAQQGKKVLLIDADLRKPTVHFTFKLDN
                                 TSAGPEEGKSTTAANLAVVFAQQGKKVLLIDADLRKPTVHFTFKLDN
                                        GKS                 LLIDADLR            
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GTGLTSLLLKQIPFQKAVLRAEEANLDILTSGPIPPNPAELLSTGAMRDLLSEAALVYDKVILDTPPVLAVADTKILGSY
GTGLTSLLLKQIPFQKAVLRAEEANLDILTSGPIPPNPAELLSTGAMRDLLSEAALVYDKVILDTPPVLAVADTKILGSY
                                                            VILDTPP             
       170       180       190       200       210   
....:....|....:....|....:....|....:....|....:....|...
TDGAIMVISSGKTDKEKAAKAKEALDYCPCKLLGAVMNGKKQTKHSDYAYYGQ
TDGAIMVISSGKTDKEKAAKAKEALDYCPCKLLGAVMNGKKQTKHSDYAYYGQ
                                               YAYY  
© 1998-2019