BYKdb

Annotate results for A0A0Y0NR49

A0A0Y0NR49 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0Y0NR49
DOMAINcd41/227TSVKPGEGKSTTSTNIAWAFAHAGYKTLLIDADIRNSVMSGVFRFSEKITGLTEFLSGTT
DLSQGLCDTNVENLFVIQAGSISPNPTALLQSENFRTMIDTLRKYFDYIIVDTAPIGIVI
DAVIVTQKCDASVLITAVGEVHRRDVQKAKEHLEQTGKPFLGVVLSKLNTSIEKYSSYGG
YGNYGNK
SITEWalker A48/50GKS
SITEWalker A'68/75LLIDADIR
SITEWalker B149/155IIVDTAP
SITE-145/-148YFDY
SITEY Cluster215/224YSSYGGYGNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPTLEITQKKLEIVKKAEEYYNALRTNIQLSGDNLKVISITSVKPGEGKSTTSTNIAWAFAHAGYKTLLIDADIRNSVMS
                                        TSVKPGEGKSTTSTNIAWAFAHAGYKTLLIDADIRNSVMS
                                               GKS                 LLIDADIR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GVFRFSEKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSISPNPTALLQSENFRTMIDTLRKYFDYIIVDTAPIGIVI
GVFRFSEKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSISPNPTALLQSENFRTMIDTLRKYFDYIIVDTAPIGIVI
                                                                    IIVDTAP     
       170       180       190       200       210       220       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
DAVIVTQKCDASVLITAVGEVHRRDVQKAKEHLEQTGKPFLGVVLSKLNTSIEKYSSYGGYGNYGNK
DAVIVTQKCDASVLITAVGEVHRRDVQKAKEHLEQTGKPFLGVVLSKLNTSIEKYSSYGGYGNYGNK
                                                      YSSYGGYGNY   
© 1998-2019