BYKdb

Annotate results for A0A0Y9AUF9

A0A0Y9AUF9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0Y9AUF9
DOMAINcd47/228TSEKPGAGKSTVVSNVAITYAQAGYKTLIIDGDMRKPTQNYIFNEQNNNGLSNLIIGRTT
MSEAITTTEIDNLDLLTAGPVPPNPTELIGSERFKELVNLFNERYDIIIVDTPPVNTVTD
AQLYARAIKDSLLVIDSEKNDKNEVKKAKTLMEKAGSNILGVILNKAKVDKSSSYYHYYG
DE
SITEWalker A54/56GKS
SITEWalker A'74/81LIIDGDMR
SITEWalker B154/160IIVDTPP
SITE-66/-71YAQAGY
SITEY Cluster221/225YYHYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLIIDGDM
                                              TSEKPGAGKSTVVSNVAITYAQAGYKTLIIDGDM
                                                     GKS                 LIIDGDM
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKPTQNYIFNEQNNNGLSNLIIGRTTMSEAITTTEIDNLDLLTAGPVPPNPTELIGSERFKELVNLFNERYDIIIVDTPP
RKPTQNYIFNEQNNNGLSNLIIGRTTMSEAITTTEIDNLDLLTAGPVPPNPTELIGSERFKELVNLFNERYDIIIVDTPP
R                                                                        IIVDTPP
       170       180       190       200       210       220        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
VNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKTLMEKAGSNILGVILNKAKVDKSSSYYHYYGDE
VNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKTLMEKAGSNILGVILNKAKVDKSSSYYHYYGDE
                                                            YYHYY   
© 1998-2019