BYKdb

Annotate results for A0A101D6X9

A0A101D6X9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A101D6X9
DOMAINcd42/231TSSLPNEGKSTIVKNLSYSVALTGSKVIVIDADLRNPTVHKTFNLSNSRGLTNLLIDEGD
YEAYLNVDTSYSNLHILTSGPIPPNPAELLGSNRMKKLLSSIQENYDYVFIDSPPVVIVT
DAVVLAPVVDGVILVIQAGKTEIGAVSRAKEILESVKANILGVVLNRVKESHGGYYYYYY
YDDNKPQHRK
SITE-180/-182GKT
SITEWalker A'69/76IVIDADLR
SITEWalker B150/156VFIDSPP
SITE-102/-149YEAYLNVDTSYSNLHILTSGPIPPNPAELLGSNRMKKLLSSIQENYDY
SITEY Cluster216/222YYYYYYY
SITEWalker A49/51GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVVARNPIVADPKSPFAEAFRALRTNLQFTSVDRKVKSILITSSLPNEGKSTIVKNLSYSVALTGSKVIVIDADLRNPTV
                                         TSSLPNEGKSTIVKNLSYSVALTGSKVIVIDADLRNPTV
                                                GKS                 IVIDADLR    
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HKTFNLSNSRGLTNLLIDEGDYEAYLNVDTSYSNLHILTSGPIPPNPAELLGSNRMKKLLSSIQENYDYVFIDSPPVVIV
HKTFNLSNSRGLTNLLIDEGDYEAYLNVDTSYSNLHILTSGPIPPNPAELLGSNRMKKLLSSIQENYDYVFIDSPPVVIV
                                                                     VFIDSPP    
       170       180       190       200       210       220       230     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
TDAVVLAPVVDGVILVIQAGKTEIGAVSRAKEILESVKANILGVVLNRVKESHGGYYYYYYYDDNKPQHRKRRKR
TDAVVLAPVVDGVILVIQAGKTEIGAVSRAKEILESVKANILGVVLNRVKESHGGYYYYYYYDDNKPQHRK    
                                                       YYYYYYY             
© 1998-2019