BYKdb

Annotate results for A0A101H909

A0A101H909 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A101H909
DOMAINcd40/225TSPKEGEGKTTTLCNLAMTFALSSNSVIIVDTDLRRPKLHKLMEISNINGLTDILLKGDD
YRKYINSSVHPNLDLITSGTIPDNPSEILGSDAVKRLIEELKKDYDYVFLDTPPVVPVND
AIIMSTYVDRVILVLASGEVEQEVAIKAVRDLQKVGAKILGTVLNKVPINKQKYNYYYYY
SNELGE
SITEWalker A47/49GKT
SITEWalker A'67/74IIVDTDLR
SITEWalker B147/153VFLDTPP
SITE-100/-146YRKYINSSVHPNLDLITSGTIPDNPSEILGSDAVKRLIEELKKDYDY
SITEY Cluster213/219YNYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKDIIVHKQPKSPVSEAYRGIRTNISFDNVDKSFKSILVTSPKEGEGKTTTLCNLAMTFALSSNSVIIVDTDLRRPKLHK
                                       TSPKEGEGKTTTLCNLAMTFALSSNSVIIVDTDLRRPKLHK
                                              GKT                 IIVDTDLR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LMEISNINGLTDILLKGDDYRKYINSSVHPNLDLITSGTIPDNPSEILGSDAVKRLIEELKKDYDYVFLDTPPVVPVNDA
LMEISNINGLTDILLKGDDYRKYINSSVHPNLDLITSGTIPDNPSEILGSDAVKRLIEELKKDYDYVFLDTPPVVPVNDA
                                                                  VFLDTPP       
       170       180       190       200       210       220     
....:....|....:....|....:....|....:....|....:....|....:....|....:
IIMSTYVDRVILVLASGEVEQEVAIKAVRDLQKVGAKILGTVLNKVPINKQKYNYYYYYSNELGE
IIMSTYVDRVILVLASGEVEQEVAIKAVRDLQKVGAKILGTVLNKVPINKQKYNYYYYYSNELGE
                                                    YNYYYYY      
© 1998-2019