BYKdb

Annotate results for A0A101ID04

A0A101ID04 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A101ID04
DOMAINtad10/172RELTLEDILRIFRKRLLLFFLVVVGVVVATGIYLFLATPIYEASVTIKVDPATRSSIDIF
TAGLTGTTSSRDIATEIELIKSRSNFETVIERLELVERIYTSFEIQEMLSEGYTQNDIEA
SLAKTLSNITSVSPVKDTRIVRVSVQHRDRTIARDVANTLAEV
DOMAINcd540/729TSPLPGEGKTTVAANIAYSYAMSGQRVLLVDLDMRKPRIEQLLGMDDRSSEGIVDIVLDN
RNVGDLIIKYAENLDVLPVGKIPPNPTVLLSSKKIAALIEGLKNEYDRIIVDLPPAVITS
DVALVGHLFDGVLMVTQPGTTLRDALRMAISNLKTSGAKVLGFVVNGVTVKTSGYYYHYY
YYHYSEGTKK
SITEWalker A547/549GKT
SITEWalker A'567/574LLVDLDMR
SITEWalker B648/654IIVDLPP
SITE-557/-559YSY
SITEY Cluster714/723YYYHYYYYHY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNQTNGDDYRELTLEDILRIFRKRLLLFFLVVVGVVVATGIYLFLATPIYEASVTIKVDPATRSSIDIFTAGLTGTTSSR
         RELTLEDILRIFRKRLLLFFLVVVGVVVATGIYLFLATPIYEASVTIKVDPATRSSIDIFTAGLTGTTSSR

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DIATEIELIKSRSNFETVIERLELVERIYTSFEIQEMLSEGYTQNDIEASLAKTLSNITSVSPVKDTRIVRVSVQHRDRT
DIATEIELIKSRSNFETVIERLELVERIYTSFEIQEMLSEGYTQNDIEASLAKTLSNITSVSPVKDTRIVRVSVQHRDRT

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IARDVANTLAEVYNEKLAELSRRDATTRREFIESQIPSVEEQVRRSSDALREFKEKTGIYVLDAQARWLLDMLSNYDKQF
IARDVANTLAEV                                                                    

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NALVIELEEKKAEVVAYQKLLDEFDSPEAGALQEKWINTSHTLSLNPVITQLRNKLALLKVDLAALEDQYPATDQRIRAK


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KAEIAATEKLIQEEIENEFIRTGEGMSLNPTYQTILTAVITSETSLQIIESTIQSVDMLRKTYLDALAEIPRLEQQLLEL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QREVYISENLYTLLLERLEEAKISEAAVIGNAAVIDSALIPSAPVKPNRRLSLAIGGVLGIFLGMLGVFLAEYLDKTLKS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EEDIERVASEPILGRIPLANGIRNELFVQSDPTSPPSEAVKIASSNISFTLGDGKVIGVTSPLPGEGKTTVAANIAYSYA
                                                           TSPLPGEGKTTVAANIAYSYA
                                                                  GKT           
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSGQRVLLVDLDMRKPRIEQLLGMDDRSSEGIVDIVLDNRNVGDLIIKYAENLDVLPVGKIPPNPTVLLSSKKIAALIEG
MSGQRVLLVDLDMRKPRIEQLLGMDDRSSEGIVDIVLDNRNVGDLIIKYAENLDVLPVGKIPPNPTVLLSSKKIAALIEG
      LLVDLDMR                                                                  
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LKNEYDRIIVDLPPAVITSDVALVGHLFDGVLMVTQPGTTLRDALRMAISNLKTSGAKVLGFVVNGVTVKTSGYYYHYYY
LKNEYDRIIVDLPPAVITSDVALVGHLFDGVLMVTQPGTTLRDALRMAISNLKTSGAKVLGFVVNGVTVKTSGYYYHYYY
       IIVDLPP                                                           YYYHYYY
       730       
....:....|....:..
YHYSEGTKKRKEHRKVR
YHYSEGTKK        
YHY              

© 1998-2019