BYKdb

Annotate results for A0A101KSE4

A0A101KSE4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A101KSE4
DOMAINtad15/160LPLDVREIVDFFLRRWKLVCSIAAITFSLFVFAAYVIPASYTGVAQILLDAPIDYMTPQD
YSNSDFADNPTFIESQIAVLRSASLLQQVVDSQKLTEDPKIGPAALVWLQTSLGVSRVGL
GNVIELDVSMYDPEKAASLANAIAQA
DOMAINcd508/695TSAMPGEGKTTLVLSLACSAVADGKRVLVIDADLRLSATTAFFGMADKVGLVDLLTLPVK
AANAIHLDERSGISLLPAGARTRNPPALLASARMRSILDELRGKFDTVIIDAPPVGPAAD
ATILARHVDKVVFVVKWRETSREAVAEGIRHLGGRSRIAGIALTMVDEPKLPRYGRYTSL
ESSVSDSY
SITEWalker A515/517GKT
SITEWalker A'535/542LVIDADLR
SITEWalker B615/621VIIDAPP
SITEY Cluster681/696YGRYTSLESSVSDSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MASPTDNPTMIREFLPLDVREIVDFFLRRWKLVCSIAAITFSLFVFAAYVIPASYTGVAQILLDAPIDYMTPQDYSNSDF
              LPLDVREIVDFFLRRWKLVCSIAAITFSLFVFAAYVIPASYTGVAQILLDAPIDYMTPQDYSNSDF

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADNPTFIESQIAVLRSASLLQQVVDSQKLTEDPKIGPAALVWLQTSLGVSRVGLGNVIELDVSMYDPEKAASLANAIAQA
ADNPTFIESQIAVLRSASLLQQVVDSQKLTEDPKIGPAALVWLQTSLGVSRVGLGNVIELDVSMYDPEKAASLANAIAQA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YVADRIKSRYEGVQKASTWLSDRASYLRAELSRSEQAVQKFRIDHNLLATPAGSLTDQQMSELNIALINARAELSEKRAQ


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YQQVDKLRTAGGDIQSMPDVLQSVVVTALRSQLSLVSRKEADLKLKYGERHPDVMAAQAERHDIEGQIAAEVQRLIGNLK


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NEVDSAEAREASLARALGSVSNQSEIEGQVGVQLRDLERIAAANKELFETFLSRAKLTEEKSTLLNSGVHVITAAVVPIS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PSFPNRSLFAALGLVFGIFFGGAGAVLRELFASGFMAKKQIEDELAVPVLASMPRMSGWSKDAQSQAQPVAYLERKPLSR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YSEAVRRLRLGLEATPEWDRSPRLMLVTSAMPGEGKTTLVLSLACSAVADGKRVLVIDADLRLSATTAFFGMADKVGLVD
                           TSAMPGEGKTTLVLSLACSAVADGKRVLVIDADLRLSATTAFFGMADKVGLVD
                                  GKT                 LVIDADLR                  
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLTLPVKAANAIHLDERSGISLLPAGARTRNPPALLASARMRSILDELRGKFDTVIIDAPPVGPAADATILARHVDKVVF
LLTLPVKAANAIHLDERSGISLLPAGARTRNPPALLASARMRSILDELRGKFDTVIIDAPPVGPAADATILARHVDKVVF
                                                      VIIDAPP                   
       650       660       670       680       690        
....:....|....:....|....:....|....:....|....:....|....:...
VVKWRETSREAVAEGIRHLGGRSRIAGIALTMVDEPKLPRYGRYTSLESSVSDSYYLN
VVKWRETSREAVAEGIRHLGGRSRIAGIALTMVDEPKLPRYGRYTSLESSVSDSY   
                                        YGRYTSLESSVSDSYY  
© 1998-2019