BYKdb

Annotate results for A0A101KZQ4

A0A101KZQ4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A101KZQ4
DOMAINcd206/395TSALPGEGKSTVAANLAITIAASDQKVVLIDGDLRRPTIAKTFGLLEGVGLTDVLIGNAD
IDDVMQPWGESGNLVVLGAGKIPPNPSELLGSNTFQNLIQSLAQEAIVLIDAPPLLPVTD
AAILTARTDGALVVSRVRKTTYDELESALNNLQRVNAHALGLILNGVPLKGAQASNYGYA
YKAYYRQDTK
SITEWalker A213/215GKS
SITEWalker A'233/240VLIDGDLR
SITEWalker B313/319VLIDAPP
SITEY Cluster382/390YGYAYKAYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAKSRSVALDVQENLGIDTSINQLLSSISIANPVDTATLKVSAESNTPESAQQLAEAWVKAIENQVSEVENSSATKSSSA


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SIVTFRSFDAAELPTSPSSPNFKIAIAVGLLVGLFMAFAYAMLRHAFDRRISSIESVESSTGHSVIGTIPQTDTLDREQR


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LITSIGGNDRNEEHAGEYAVAESIRELRTNLQFMNIDNPPRTIVITSALPGEGKSTVAANLAITIAASDQKVVLIDGDLR
                                             TSALPGEGKSTVAANLAITIAASDQKVVLIDGDLR
                                                    GKS                 VLIDGDLR
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RPTIAKTFGLLEGVGLTDVLIGNADIDDVMQPWGESGNLVVLGAGKIPPNPSELLGSNTFQNLIQSLAQEAIVLIDAPPL
RPTIAKTFGLLEGVGLTDVLIGNADIDDVMQPWGESGNLVVLGAGKIPPNPSELLGSNTFQNLIQSLAQEAIVLIDAPPL
                                                                        VLIDAPP 
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LPVTDAAILTARTDGALVVSRVRKTTYDELESALNNLQRVNAHALGLILNGVPLKGAQASNYGYAYKAYYRQDTKGRRSA
LPVTDAAILTARTDGALVVSRVRKTTYDELESALNNLQRVNAHALGLILNGVPLKGAQASNYGYAYKAYYRQDTK     
                                                             YGYAYKAYY          
       410
....:....|
VANPVANDEA


© 1998-2019