BYKdb

Annotate results for A0A101LA70

A0A101LA70 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A101LA70
DOMAINtad1/136MELTDYWKVLRAHWVSVIAITLVGGIAAFGWTLTQTKVYSADASGIISVGVNKDLGTAMA
GESYSKSRAKSYLDVAKSRSVAETVIDDLKLQGTTPEQLISRISAQNPQDTATLKFTAQA
STPESARDLAEAWVRA
DOMAINcd280/469TSALPGEGKTTVVANLAQTIAASGQRVVVVDGDLRRPTVAKTFGLLTNVGLTDVLIGRAT
LNDVLQPWGESGDLFVLGAGSVPPNPSELLGSNAMHSMLEDIAKHAIVLVDAPPLLPVTD
AAILTARTDGALVVSRAGKTTYDQLKRALQNLERVRGRPLGLIINGVSRKSTKGEDYGYQ
YYTYYNRKDS
SITE-417/-419GKT
SITEWalker A'307/314VVVDGDLR
SITEWalker B387/393VLVDAPP
SITEY Cluster456/464YGYQYYTYY
SITEWalker A287/289GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MELTDYWKVLRAHWVSVIAITLVGGIAAFGWTLTQTKVYSADASGIISVGVNKDLGTAMAGESYSKSRAKSYLDVAKSRS
MELTDYWKVLRAHWVSVIAITLVGGIAAFGWTLTQTKVYSADASGIISVGVNKDLGTAMAGESYSKSRAKSYLDVAKSRS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAETVIDDLKLQGTTPEQLISRISAQNPQDTATLKFTAQASTPESARDLAEAWVRAVGQQVDQLERGGAKAGETSIVSFV
VAETVIDDLKLQGTTPEQLISRISAQNPQDTATLKFTAQASTPESARDLAEAWVRA                        

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLDAAQLPTSPTSPNTRLALMIGVVAGLLVAIGYALLRNIFDRRVRSAAQLESETGVAVIGTVPFHTNFDGVNRLVLSRG


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GNDLENKNHQDYAVAEAIRELRTNLQFMDVDAPPRIIVVTSALPGEGKTTVVANLAQTIAASGQRVVVVDGDLRRPTVAK
                                       TSALPGEGKTTVVANLAQTIAASGQRVVVVDGDLRRPTVAK
                                              GKT                 VVVDGDLR      
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TFGLLTNVGLTDVLIGRATLNDVLQPWGESGDLFVLGAGSVPPNPSELLGSNAMHSMLEDIAKHAIVLVDAPPLLPVTDA
TFGLLTNVGLTDVLIGRATLNDVLQPWGESGDLFVLGAGSVPPNPSELLGSNAMHSMLEDIAKHAIVLVDAPPLLPVTDA
                                                                  VLVDAPP       
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AILTARTDGALVVSRAGKTTYDQLKRALQNLERVRGRPLGLIINGVSRKSTKGEDYGYQYYTYYNRKDSGEESARATHVP
AILTARTDGALVVSRAGKTTYDQLKRALQNLERVRGRPLGLIINGVSRKSTKGEDYGYQYYTYYNRKDS           
                                                       YGYQYYTYY                
       490       500       510
....:....|....:....|....:....|
VDESRPVEATALEPLGEQRRGRRRERTHAL


© 1998-2019