BYKdb

Annotate results for A0A101LAM5

A0A101LAM5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A101LAM5
DOMAINtad1/135MSGNDLLSVVRSHWLGILFITVLMVGGSLGWYALQPKVYSAESSGIVVAAGAENLGMSLA
GDSLAKSKAKGYQSVGESILVAESVIKSLGLKESAPDVTRSISVSVPLDSVEIRVSARSS
DPQTAQNVADAWVTA
DOMAINcd276/464TSSLPSEGKSTVTSNLAATIAAAGRDVIVVDADLRRPTVHQVFGVLPDVGVTDVLSGRAS
IDDVLQEWGPNPHLRILTAGRIPPNPSELLGSRAMEHLLRDLSQRAMVLIDAPPLLPVTD
AAVLSRVADGTLVVARARKTTRDTLYRALGNLTRVRGRVLGVILNCVATKGPGDLNYGYY
GAYGSAEDL
SITEWalker A283/285GKS
SITEWalker A'303/310IVVDADLR
SITEWalker B383/389VLIDAPP
SITEY Cluster452/458YGYYGAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSGNDLLSVVRSHWLGILFITVLMVGGSLGWYALQPKVYSAESSGIVVAAGAENLGMSLAGDSLAKSKAKGYQSVGESIL
MSGNDLLSVVRSHWLGILFITVLMVGGSLGWYALQPKVYSAESSGIVVAAGAENLGMSLAGDSLAKSKAKGYQSVGESIL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAESVIKSLGLKESAPDVTRSISVSVPLDSVEIRVSARSSDPQTAQNVADAWVTALAAQVYELDKGNASPGTEPVTKIVP
VAESVIKSLGLKESAPDVTRSISVSVPLDSVEIRVSARSSDPQTAQNVADAWVTA                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAKASLPSAPVSPLLTATLGIGLAAGLLIGLGYALARNHLDRRIRGASEIERLFGLAVVGTLPLDKRLSEKSSVLESTTG


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MHRVPGGHAMAEALRELRTNLDFIDVDNPPRILLITSSLPSEGKSTVTSNLAATIAAAGRDVIVVDADLRRPTVHQVFGV
                                   TSSLPSEGKSTVTSNLAATIAAAGRDVIVVDADLRRPTVHQVFGV
                                          GKS                 IVVDADLR          
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LPDVGVTDVLSGRASIDDVLQEWGPNPHLRILTAGRIPPNPSELLGSRAMEHLLRDLSQRAMVLIDAPPLLPVTDAAVLS
LPDVGVTDVLSGRASIDDVLQEWGPNPHLRILTAGRIPPNPSELLGSRAMEHLLRDLSQRAMVLIDAPPLLPVTDAAVLS
                                                              VLIDAPP           
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RVADGTLVVARARKTTRDTLYRALGNLTRVRGRVLGVILNCVATKGPGDLNYGYYGAYGSAEDLKDHQPPAPSTTTTSAS
RVADGTLVVARARKTTRDTLYRALGNLTRVRGRVLGVILNCVATKGPGDLNYGYYGAYGSAEDL                
                                                   YGYYGAY                      
       490       500       510       520    
....:....|....:....|....:....|....:....|....
RRSPDADAVNPVPDIREASPFLGSVSTWRAPQDGSRGRRSAPPS


© 1998-2019