BYKdb

Annotate results for A0A101V7M0

A0A101V7M0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A101V7M0
DOMAINtad35/204ISIDLEAIWAAIYRSRFWIAGIVLGCLLLGVVITILSTPIFRAIATVQIDQEAAKVLGTE
DADATASIFDSDRFLQTQLDVIRSRSLAQAVAEDLQLFDNPRFLEQMNVDAGSVEASVLP
PEEAQRELVIETLDENLSVSLPLDSRIASIAFNSPDGSLAARIANSFAEN
DOMAINcd550/736TSAVQGEGKSSSCYATAVALSRIGKRVLVIDLDLRRPNQHNLFGIKNGEGMSDLLTGNKQ
AAEVTHATEHEGIFFIPSGGIPPNPTDMLASPALRTVLQDLNTQYDIVLVDSPPTLGLAD
AIEIASVTEGCLFVTEAGRNRANNVRGSISRLQGGGAKVLGVLMTKFDAKSAGYSYSYGY
SYDYKNG
SITEWalker A557/559GKS
SITEWalker A'577/584LVIDLDLR
SITEWalker B657/663VLVDSPP
SITEY Cluster723/733YSYSYGYSYDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNRAESHIETMGGNGRVAATFDDRYDADYERSGLISIDLEAIWAAIYRSRFWIAGIVLGCLLLGVVITILSTPIFRAIAT
                                  ISIDLEAIWAAIYRSRFWIAGIVLGCLLLGVVITILSTPIFRAIAT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VQIDQEAAKVLGTEDADATASIFDSDRFLQTQLDVIRSRSLAQAVAEDLQLFDNPRFLEQMNVDAGSVEASVLPPEEAQR
VQIDQEAAKVLGTEDADATASIFDSDRFLQTQLDVIRSRSLAQAVAEDLQLFDNPRFLEQMNVDAGSVEASVLPPEEAQR

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELVIETLDENLSVSLPLDSRIASIAFNSPDGSLAARIANSFAENYIRNNLQRKFDTSSYAREFLQEQLQEAAIRLAESER
ELVIETLDENLSVSLPLDSRIASIAFNSPDGSLAARIANSFAEN                                    

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AALEYARRTRVIDASNAADASRYSTANPRSLVTATLVQLNSDYSAALSRRIAAQQAWETARAQDPINLPQALNNLAVQNL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LEERAKVQAEYEQELQRRKEEFPSVKQAKARLDELDRQINTIATSIQQTIKASYEIALEQERALESQIVQLKTETLDEQE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGVQLGILQRQTANDRQLYDLLLTRFNALNAEAGVQANNVSIVDRATRPVEPVSPNIPLNLALALLGGIGLAGLFVFGRE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QFFDMLRTPDDVARKLSLPLLGASPKADEGQSVQELILDPKTEVSEHYASLRSSLVLATSHGLPKSLAFTSAVQGEGKSS
                                                                     TSAVQGEGKSS
                                                                            GKS 
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SCYATAVALSRIGKRVLVIDLDLRRPNQHNLFGIKNGEGMSDLLTGNKQAAEVTHATEHEGIFFIPSGGIPPNPTDMLAS
SCYATAVALSRIGKRVLVIDLDLRRPNQHNLFGIKNGEGMSDLLTGNKQAAEVTHATEHEGIFFIPSGGIPPNPTDMLAS
                LVIDLDLR                                                        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PALRTVLQDLNTQYDIVLVDSPPTLGLADAIEIASVTEGCLFVTEAGRNRANNVRGSISRLQGGGAKVLGVLMTKFDAKS
PALRTVLQDLNTQYDIVLVDSPPTLGLADAIEIASVTEGCLFVTEAGRNRANNVRGSISRLQGGGAKVLGVLMTKFDAKS
                VLVDSPP                                                         
       730      
....:....|....:.
AGYSYSYGYSYDYKNG
AGYSYSYGYSYDYKNG
  YSYSYGYSYDY   

© 1998-2019