BYKdb

Annotate results for A0A101Y8M3

A0A101Y8M3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A101Y8M3
DOMAINtad1/135MTVIDFLRLTRANLVLLLAATLAGLLLAFGVALAQPKIYTSSSTGFVTTTGSSSLGDVLN
GDVAAQNKANAYIPVISSRSVAEKIAQDPALGLTADEVAGHLTASVVPNSALIKVDATAD
DPEKSAALANSALQA
DOMAINcd261/449TSPNPGEGKSTVTTAIANSFAHAGEAAVIVDADLRRPTVAGVFGVDGSVGLTQVLSGQVA
LQDALQQVPGSSLMVLPAGRIPPNPSELVGSQRMKHVLTELRESYMVFVDAPPVLPVTDA
SLLAAAADGAILVIEVGGTRKEQVELAASMLRRVSVTLLGAVLNLAPARGVGSSHYGFGY
GGYRRGYSS
SITEWalker A268/270GKS
SITEWalker A'288/295VIVDADLR
SITEWalker B367/373VFVDAPP
SITEY Cluster436/451YGFGYGGYRRGYSSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTVIDFLRLTRANLVLLLAATLAGLLLAFGVALAQPKIYTSSSTGFVTTTGSSSLGDVLNGDVAAQNKANAYIPVISSRS
MTVIDFLRLTRANLVLLLAATLAGLLLAFGVALAQPKIYTSSSTGFVTTTGSSSLGDVLNGDVAAQNKANAYIPVISSRS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAEKIAQDPALGLTADEVAGHLTASVVPNSALIKVDATADDPEKSAALANSALQATAEVVQDLEGNSSPVRVVPLEDAQV
VAEKIAQDPALGLTADEVAGHLTASVVPNSALIKVDATADDPEKSAALANSALQA                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PGGPSSPNTKRYLLAGAAAGLLAGYAVALLRKVSDVRIRTSHEVEELTDAGVLGILPKTPSLKGNNRGEVEDDAAHEAVR


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLRTNLRFVSVDNPPRCVVVTSPNPGEGKSTVTTAIANSFAHAGEAAVIVDADLRRPTVAGVFGVDGSVGLTQVLSGQVA
                    TSPNPGEGKSTVTTAIANSFAHAGEAAVIVDADLRRPTVAGVFGVDGSVGLTQVLSGQVA
                           GKS                 VIVDADLR                         
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQDALQQVPGSSLMVLPAGRIPPNPSELVGSQRMKHVLTELRESYMVFVDAPPVLPVTDASLLAAAADGAILVIEVGGTR
LQDALQQVPGSSLMVLPAGRIPPNPSELVGSQRMKHVLTELRESYMVFVDAPPVLPVTDASLLAAAADGAILVIEVGGTR
                                              VFVDAPP                           
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KEQVELAASMLRRVSVTLLGAVLNLAPARGVGSSHYGFGYGGYRRGYSSYYGETKKSSRGFRAKRRATPDRARSRRSSSA
KEQVELAASMLRRVSVTLLGAVLNLAPARGVGSSHYGFGYGGYRRGYSS                               
                                   YGFGYGGYRRGYSSYY                             
       490  
....:....|..
GSSASSHSARDV


© 1998-2019