BYKdb

Annotate results for A0A102D7C8

A0A102D7C8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A102D7C8
DOMAINtad39/196DRIDLKFLIGIFRRRSGLFVSVLGGSLAIGAIVTALQPRIYVAHADVTLSNKTAMIAPAS
TNDRVTEQQAPTDAFVDTQVAQVTSSDNMNAVIDRLGLDKDPRIVAEAGRGAARLATIDY
LRKHLNVQRIGSTYDIGITYDSRSADQAAKVANAFAEQ
DOMAINcd540/731TSSLPDEGKTTTSICLARSMAASGDRVLLIDCDLRRQGVSEFVPDREGRPGLIEVLRGEV
ELDAAISVDPATGLAILPVSRDTTDAPELLTGDEMDRLLETARAKYHAVIIDTAPVLPIA
DARLVLGKADASVFVVRWRKTPDSALRAALRLLPGNRVQLAGVALTRVDMRKQARFGYGE
DAFYHSYRRYYS
SITEWalker A547/549GKT
SITEWalker A'567/574LLIDCDLR
SITEWalker B648/654VIIDTAP
SITEY Cluster717/730YGEDAFYHSYRRYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSTAVNTLDSSAVGALRGPGDVLPAWLAEPRAVPVAGNDRIDLKFLIGIFRRRSGLFVSVLGGSLAIGAIVTALQPRIYV
                                      DRIDLKFLIGIFRRRSGLFVSVLGGSLAIGAIVTALQPRIYV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AHADVTLSNKTAMIAPASTNDRVTEQQAPTDAFVDTQVAQVTSSDNMNAVIDRLGLDKDPRIVAEAGRGAARLATIDYLR
AHADVTLSNKTAMIAPASTNDRVTEQQAPTDAFVDTQVAQVTSSDNMNAVIDRLGLDKDPRIVAEAGRGAARLATIDYLR

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KHLNVQRIGSTYDIGITYDSRSADQAAKVANAFAEQFTRGALDAKRDGARQTTGMIAARLDQLRSQALADSAAEQNYRIA
KHLNVQRIGSTYDIGITYDSRSADQAAKVANAFAEQ                                            

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HNLLSTNQGTLTEQEISAYNQELARARAEQAEDAARLDAARHQQAGAANGGNVGETLASPAIAALRAQQATAAGELASLQ


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARYGSLHPDVIKARATLRALDEQVAGETRRVIAGLEAKAQASDQRLASLSGSLTQSRGALAISNSAKTGLQDLEKRAETS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NALYESYLNRYKELTAREGTEQADAEMLHPASVPLVPDSPHVLINLILSFAVGLGLGVAAAFLAELNYSGITTGDDIEQR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGVRYLGSIPSLGSVMVRGRKASPTEALIESPRSAFAESFRSLRASIAMNTTNAKVIAITSSLPDEGKTTTSICLARSMA
                                                           TSSLPDEGKTTTSICLARSMA
                                                                  GKT           
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASGDRVLLIDCDLRRQGVSEFVPDREGRPGLIEVLRGEVELDAAISVDPATGLAILPVSRDTTDAPELLTGDEMDRLLET
ASGDRVLLIDCDLRRQGVSEFVPDREGRPGLIEVLRGEVELDAAISVDPATGLAILPVSRDTTDAPELLTGDEMDRLLET
      LLIDCDLR                                                                  
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARAKYHAVIIDTAPVLPIADARLVLGKADASVFVVRWRKTPDSALRAALRLLPGNRVQLAGVALTRVDMRKQARFGYGED
ARAKYHAVIIDTAPVLPIADARLVLGKADASVFVVRWRKTPDSALRAALRLLPGNRVQLAGVALTRVDMRKQARFGYGED
       VIIDTAP                                                              YGED
       730 
....:....|.
AFYHSYRRYYS
AFYHSYRRYYS
AFYHSYRRYY 

© 1998-2019