BYKdb

Annotate results for A0A102KAL9

A0A102KAL9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A102KAL9
DOMAINtad15/273DEVTLAAVLDVLLSHRWTVALTTAACFAAGMLYAFLCHPLYQADILVQVEDSNDASAVKS
AFGDVSSLFDVKSTAAAEAQVLASRFVVTRAVDTLRSYIVVEPKRFPIVGDFISRLNSGI
ALPGVLGIGGYAWGDERAELARFDVPKPLEGDRFELTMLDADRYQLAGSALPEPVTGQLG
RVGRFSTDEGPIVIDVTRFDAYPGTAFTLVRESRTTTINALRRALDVQEKIKQSGVIVAT
LRGPDPLRVQAELREIANH
DOMAINcd550/741SSPVPGAGKSFVSANFAALLAATGLQVLLIDGDLRRGHLHAYFGVTREYGFRELAAGAIA
PQDAIHANVVPNLDFIATGEFPPNPTELLADPRITAAIGTLSARYDVVVVDSAPILPVTD
AVLLGRCAGTALLVARAGKTRVAELSEAIRRLAHGGIATSGVLLNGVDSRSPRYGTRHGA
YRYSQYDYAPVE
SITE-687/-689GKT
SITEWalker A'577/584LLIDGDLR
SITEWalker B657/663VVVDSAP
SITEY Cluster730/737YRYSQYDY
SITEWalker A557/559GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTSLQSPKRIDDRADEVTLAAVLDVLLSHRWTVALTTAACFAAGMLYAFLCHPLYQADILVQVEDSNDASAVKSAFGDVS
              DEVTLAAVLDVLLSHRWTVALTTAACFAAGMLYAFLCHPLYQADILVQVEDSNDASAVKSAFGDVS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLFDVKSTAAAEAQVLASRFVVTRAVDTLRSYIVVEPKRFPIVGDFISRLNSGIALPGVLGIGGYAWGDERAELARFDVP
SLFDVKSTAAAEAQVLASRFVVTRAVDTLRSYIVVEPKRFPIVGDFISRLNSGIALPGVLGIGGYAWGDERAELARFDVP

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KPLEGDRFELTMLDADRYQLAGSALPEPVTGQLGRVGRFSTDEGPIVIDVTRFDAYPGTAFTLVRESRTTTINALRRALD
KPLEGDRFELTMLDADRYQLAGSALPEPVTGQLGRVGRFSTDEGPIVIDVTRFDAYPGTAFTLVRESRTTTINALRRALD

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VQEKIKQSGVIVATLRGPDPLRVQAELREIANHYIRQNIERKSADAAQSLSFLGKQLPQLKQQLQAAEQRYTNMRNANGT
VQEKIKQSGVIVATLRGPDPLRVQAELREIANH                                               

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDLSEESKLILQQTADAKTRLLELRQKRDEMMTRFTPDHPDMLALGAQIATLERQQQAFDQQVKRLPDLQQEALRLMLDV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KVDTDLYTGLLANAQQLELVKAGKTGNVRLVDAPIVPEKPVRPNRPAVIGIAALIGLLLGTAIAFARDFLFGGVDSADEI


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ERRLGVSVYATIPDSVSQRKIARQMAVRAPGPHLLGTHHPCDPAIESLRSLCTALHFAMQDARNNVLLLSSPVPGAGKSF
                                                                     SSPVPGAGKSF
                                                                            GKS 
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSANFAALLAATGLQVLLIDGDLRRGHLHAYFGVTREYGFRELAAGAIAPQDAIHANVVPNLDFIATGEFPPNPTELLAD
VSANFAALLAATGLQVLLIDGDLRRGHLHAYFGVTREYGFRELAAGAIAPQDAIHANVVPNLDFIATGEFPPNPTELLAD
                LLIDGDLR                                                        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PRITAAIGTLSARYDVVVVDSAPILPVTDAVLLGRCAGTALLVARAGKTRVAELSEAIRRLAHGGIATSGVLLNGVDSRS
PRITAAIGTLSARYDVVVVDSAPILPVTDAVLLGRCAGTALLVARAGKTRVAELSEAIRRLAHGGIATSGVLLNGVDSRS
                VVVDSAP                                                         
       730       740       750       760     
....:....|....:....|....:....|....:....|....:
PRYGTRHGAYRYSQYDYAPVEHHAASQLVRVLRAFAARVRQGGVR
PRYGTRHGAYRYSQYDYAPVE                        
         YRYSQYDY                            

© 1998-2019