BYKdb

Annotate results for A0A106JDI3

A0A106JDI3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A106JDI3
DOMAINtad17/271DAPSVRGVMRLLGDHLWTVAGITLAVVMLAGAYVWLVSPVYSSSAVIRVDAQDRNALGFA
PEGQLVLGQKPPRTDAEIGMMQSRKVLDPVLTHYGYDITVKPRMVPLLGAIARKFATPGE
PSRAWLGLDSYAWGGERVDIDSLRVPADLENKKLRLRALENGTFELRDTHGYVLLSGRVG
QRIETGGTSILIERLDARPHTEFDVVAWNGVNALQRFSSNLKIVEKGRETGIVQITFDSN
DPAVSANVANAIAQG
DOMAINcd583/771TGPTPGTGKSFIAANLAVLEAETTRRVLLVDADMRCGRLASFFGKSNSGGLAELLAGRLH
IDQAIQTAGIPGLSLVSCGRYPGNPSELLMMPSFRSLLEEFKRRFDLVIIDTPPLLAVSD
AAIVANGAGRTVLVLRSGTQTEEEIEETVTRLERVGASIVGAVFNAVPLRRSERRSYGYV
STYLNRNRI
SITE-626/-628GKS
SITEWalker A'610/617LLVDADMR
SITEWalker B690/696VIIDTPP
SITEY Cluster759/765YGYVSTY
SITEWalker A590/592GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNIPNINARNFGGLPEDAPSVRGVMRLLGDHLWTVAGITLAVVMLAGAYVWLVSPVYSSSAVIRVDAQDRNALGFAPEGQ
                DAPSVRGVMRLLGDHLWTVAGITLAVVMLAGAYVWLVSPVYSSSAVIRVDAQDRNALGFAPEGQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVLGQKPPRTDAEIGMMQSRKVLDPVLTHYGYDITVKPRMVPLLGAIARKFATPGEPSRAWLGLDSYAWGGERVDIDSLR
LVLGQKPPRTDAEIGMMQSRKVLDPVLTHYGYDITVKPRMVPLLGAIARKFATPGEPSRAWLGLDSYAWGGERVDIDSLR

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VPADLENKKLRLRALENGTFELRDTHGYVLLSGRVGQRIETGGTSILIERLDARPHTEFDVVAWNGVNALQRFSSNLKIV
VPADLENKKLRLRALENGTFELRDTHGYVLLSGRVGQRIETGGTSILIERLDARPHTEFDVVAWNGVNALQRFSSNLKIV

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EKGRETGIVQITFDSNDPAVSANVANAIAQGYVATTVAERRANDSKTLEFINSELPRLREELRQAETTLMGYEASVGSLR
EKGRETGIVQITFDSNDPAVSANVANAIAQG                                                 

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PTAEAQSYLQGGIDIERQIAMLQLQRTQMSQNFTPSSAPMRNIDQQLAQLNAAKAQFDSRFTRMPASERTNADLSRNAKV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEAIYIAMVNKAEELTVRRAGTTGDVHIVDSAIRPADPVSPAVPIVMSASVGIGLMLGSLFVCARSRYLTGVTDSKFIER


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SMRVPILGSILYSAEQVRLGHTMPRRLTFESTEDGSHRQPSLLLSSNRPAGNAAEDSTSQATSHYLLARIFPHDTTVEAL


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RGVRTALHLNETGKADDGVVVLTGPTPGTGKSFIAANLAVLEAETTRRVLLVDADMRCGRLASFFGKSNSGGLAELLAGR
                      TGPTPGTGKSFIAANLAVLEAETTRRVLLVDADMRCGRLASFFGKSNSGGLAELLAGR
                             GKS                 LLVDADMR                       
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LHIDQAIQTAGIPGLSLVSCGRYPGNPSELLMMPSFRSLLEEFKRRFDLVIIDTPPLLAVSDAAIVANGAGRTVLVLRSG
LHIDQAIQTAGIPGLSLVSCGRYPGNPSELLMMPSFRSLLEEFKRRFDLVIIDTPPLLAVSDAAIVANGAGRTVLVLRSG
                                                 VIIDTPP                        
       730       740       750       760       770   
....:....|....:....|....:....|....:....|....:....|...
TQTEEEIEETVTRLERVGASIVGAVFNAVPLRRSERRSYGYVSTYLNRNRIVV
TQTEEEIEETVTRLERVGASIVGAVFNAVPLRRSERRSYGYVSTYLNRNRI  
                                      YGYVSTY        

© 1998-2019