BYKdb

Annotate results for A0A108C6R5

A0A108C6R5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A108C6R5
DOMAINtad17/274SPQSTRRYWSKLYGGRRLIVGSVLACTLVGALYALCARPVYRSDILFQVEQSPIETKTQS
NDPSAVFDLKTDASTEIELLKSRAVMSRAVDGVKLYIDATPRYLPMIGWRFADAADSLST
PLPGGYVSGTERIDVATFNVPKLLYEKRFVVTAGRDGAYTLQRNGLLGTKGPVWQGRVGE
SLHVDTPQGPIDVLVRDLAGAPGARFDLTRYGENETIERLQKVALIAERGKQSNMIGVTL
DSTDPVRGSRILDAIGNA
DOMAINcd548/735TGPTTRVGKSFVASNLAMLAGASNRRVLLIDADLRRGSLHDRFRYSRGPGLADVITGTHR
LDEALKRTAVPGVEFISMGSVTPNPSELLLQPELATLIKGASSQYDVIVIDGPPLLPVAD
ALVLGRMAGTVLMVVRSGVTTATEIDESVRRLAQANVTIGGVILNDFQRRPGQYDYSHAD
PDNRQSAS
SITEWalker A555/557GKS
SITEWalker A'575/582LLIDADLR
SITEWalker B655/661IVIDGPP
SITEY Cluster721/723YDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTNLTLPGTHDVIAMRSPQSTRRYWSKLYGGRRLIVGSVLACTLVGALYALCARPVYRSDILFQVEQSPIETKTQSNDPS
                SPQSTRRYWSKLYGGRRLIVGSVLACTLVGALYALCARPVYRSDILFQVEQSPIETKTQSNDPS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVFDLKTDASTEIELLKSRAVMSRAVDGVKLYIDATPRYLPMIGWRFADAADSLSTPLPGGYVSGTERIDVATFNVPKLL
AVFDLKTDASTEIELLKSRAVMSRAVDGVKLYIDATPRYLPMIGWRFADAADSLSTPLPGGYVSGTERIDVATFNVPKLL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YEKRFVVTAGRDGAYTLQRNGLLGTKGPVWQGRVGESLHVDTPQGPIDVLVRDLAGAPGARFDLTRYGENETIERLQKVA
YEKRFVVTAGRDGAYTLQRNGLLGTKGPVWQGRVGESLHVDTPQGPIDVLVRDLAGAPGARFDLTRYGENETIERLQKVA

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LIAERGKQSNMIGVTLDSTDPVRGSRILDAIGNAYVAQNAQRKAEAADKLIRFLDVQLPKVKSQLEAAEDRFNEFRASHG
LIAERGKQSNMIGVTLDSTDPVRGSRILDAIGNA                                              

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TVNTSDEALALRQQSIDIESRVQTLQQRREELLTRFMSKHPAVVDVDAQLADVRRSLNDVRVQIQRLPAIEQGVLQLQRD


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAVDTALYTNLLNTRQQMTLVRASRAGNARIVDPAQVAEKPVQPHRGMAVVGAMITGLLAGILIVITRQRLIGAVEDPDE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IELSTGLPVFATVPHSVSSEPQTPRLRWWPATRVPQADADPAIESLRSLRTTLQLSLPDAPNRVVLITGPTTRVGKSFVA
                                                                   TGPTTRVGKSFVA
                                                                          GKS   
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SNLAMLAGASNRRVLLIDADLRRGSLHDRFRYSRGPGLADVITGTHRLDEALKRTAVPGVEFISMGSVTPNPSELLLQPE
SNLAMLAGASNRRVLLIDADLRRGSLHDRFRYSRGPGLADVITGTHRLDEALKRTAVPGVEFISMGSVTPNPSELLLQPE
              LLIDADLR                                                          
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LATLIKGASSQYDVIVIDGPPLLPVADALVLGRMAGTVLMVVRSGVTTATEIDESVRRLAQANVTIGGVILNDFQRRPGQ
LATLIKGASSQYDVIVIDGPPLLPVADALVLGRMAGTVLMVVRSGVTTATEIDESVRRLAQANVTIGGVILNDFQRRPGQ
              IVIDGPP                                                           
       730       740        
....:....|....:....|....:...
YDYSHADPDNRQSASNYAGVMAARRPAG
YDYSHADPDNRQSAS             
YDY                         

© 1998-2019