BYKdb

Annotate results for A0A108TCU0

A0A108TCU0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A108TCU0
DOMAINtad21/267EGTVIADMLSAVYRNRKWFILSVAVCVLIGFLYLKSSPKIFLRTATVLVKDEQKGGGVNG
AAAFQDLFSLGGSTVDNEVGIFKSKRLMRTVVETLHLDISYKEWDGLRKKELYTSTPFAV
TFLDATPSQQISLTVTMSDNGKVTLADMTLQNEEEEEEFDEILTVQPGDTVNTPVGKMVV
ASTLFTDENSIGKTVYVTKGNMKEVAESYNKALNVGVANKQSSLIALSIEDENVQRAEDL
LNTLIEV
DOMAINcd602/795TSANPDSGKTFITLNLGMSMALANVKVVILDLDLRKGSLSKSVGIGMKKTGVSNYLSGKV
DDVKELVQVCGDDNRLHIITSGALPPNPAELLKSGRLDRLLEELKKNYDYILLDNPPYGV
VVDTQLCGRLADQTVYVVRSGLFDKRMLPELQELYDSGKMKNMSILLNGIDYVKTGYGYG
YGYGYGNYGNDENR
SITEWalker A609/611GKT
SITEWalker A'629/636VILDLDLR
SITEWalker B712/718ILLDNPP
SITE-709/-711YDY
SITEY Cluster773/789YVKTGYGYGYGYGYGNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGKDRFEDLDFIDFNDNRRQEGTVIADMLSAVYRNRKWFILSVAVCVLIGFLYLKSSPKIFLRTATVLVKDEQKGGGVNG
                    EGTVIADMLSAVYRNRKWFILSVAVCVLIGFLYLKSSPKIFLRTATVLVKDEQKGGGVNG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAAFQDLFSLGGSTVDNEVGIFKSKRLMRTVVETLHLDISYKEWDGLRKKELYTSTPFAVTFLDATPSQQISLTVTMSDN
AAAFQDLFSLGGSTVDNEVGIFKSKRLMRTVVETLHLDISYKEWDGLRKKELYTSTPFAVTFLDATPSQQISLTVTMSDN

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKVTLADMTLQNEEEEEEFDEILTVQPGDTVNTPVGKMVVASTLFTDENSIGKTVYVTKGNMKEVAESYNKALNVGVANK
GKVTLADMTLQNEEEEEEFDEILTVQPGDTVNTPVGKMVVASTLFTDENSIGKTVYVTKGNMKEVAESYNKALNVGVANK

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QSSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKKKNRLTDIASE
QSSLIALSIEDENVQRAEDLLNTLIEV                                                     

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SALYLQSSSMLDTEGLSVENQLNMAQYMKEYLQDNSKTTEPVPASIGIDDMGVQNLIMEYNTVLTRRNKLIANSSANNPL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VRDLNGTLMSMRLSIAKAVDNLIASLEIQVANMKNKERENSNKIAFVPTQLKYVVSIERQQKIKEELYLFLLNKKEENEL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLSITESNCRIIDPAEGVDLPVAPKKAQVALIALLAGIMLPALWIYIRSLLNTSVHTKKELKAGVNIPFLGEVPLEKNKH


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EKDIVVQEGSRESICEAFKIVRDNLDFMDTEKKTVGKVVLVTSANPDSGKTFITLNLGMSMALANVKVVILDLDLRKGSL
                                         TSANPDSGKTFITLNLGMSMALANVKVVILDLDLRKGSL
                                                GKT                 VILDLDLR    
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SKSVGIGMKKTGVSNYLSGKVDDVKELVQVCGDDNRLHIITSGALPPNPAELLKSGRLDRLLEELKKNYDYILLDNPPYG
SKSVGIGMKKTGVSNYLSGKVDDVKELVQVCGDDNRLHIITSGALPPNPAELLKSGRLDRLLEELKKNYDYILLDNPPYG
                                                                       ILLDNPP  
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVVDTQLCGRLADQTVYVVRSGLFDKRMLPELQELYDSGKMKNMSILLNGIDYVKTGYGYGYGYGYGNYGNDENRKNKKP
VVVDTQLCGRLADQTVYVVRSGLFDKRMLPELQELYDSGKMKNMSILLNGIDYVKTGYGYGYGYGYGNYGNDENR     
                                                    YVKTGYGYGYGYGYGNY           
        
....:...
LYKRIFGI


© 1998-2019