BYKdb

Annotate results for A0A109CNJ8

A0A109CNJ8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A109CNJ8
DOMAINtad31/286EDLDIGRYIDVLVSNKWLIAAITLVVFLIGASYAFLERPIYESNMVIQVEDAESGGKGIL
AEAGGLIDVKAPASAEIEIIRSRMIAGQAVEATKLYISSGPRYVPYIGGWLARRANGLSD
PGFLWLDGYVSGTERILVSQFDVPTIMEGGQFTVTAAANNQYTLDYPGMQQLKGTVGTLL
KADTPEGPITLQIDHLAGKPGALFNLYRYAKLPTTIGLQSSLVLQERGKNSGIVNVSLQD
TDPFKLTRVLNAVGEQ
DOMAINcd564/756SGPTPGVGKSFVTANFAALMAAAGKRTLLIDADLRRGHTHQYFGLQRHGGLSELIAGSLT
VQQTVHRQVVPNLDFLATGQLPPNPAELLVSDSFKTLLERLSEQYDLVVIDTPPVLVAAD
TSTVAAHVGTVLLVARADQSTMGELKESTRRLSMSGKAATGVLLNAMDLGRRTFAPYKYG
RYRYTSYNYESIL
SITEWalker A571/573GKS
SITEWalker A'591/598LLIDADLR
SITEWalker B671/677VVIDTPP
SITEY Cluster740/752YKYGRYRYTSYNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGPTHLKSIQLMTSSIITKTNPSPASAADEEDLDIGRYIDVLVSNKWLIAAITLVVFLIGASYAFLERPIYESNMVIQVE
                              EDLDIGRYIDVLVSNKWLIAAITLVVFLIGASYAFLERPIYESNMVIQVE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAESGGKGILAEAGGLIDVKAPASAEIEIIRSRMIAGQAVEATKLYISSGPRYVPYIGGWLARRANGLSDPGFLWLDGYV
DAESGGKGILAEAGGLIDVKAPASAEIEIIRSRMIAGQAVEATKLYISSGPRYVPYIGGWLARRANGLSDPGFLWLDGYV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SGTERILVSQFDVPTIMEGGQFTVTAAANNQYTLDYPGMQQLKGTVGTLLKADTPEGPITLQIDHLAGKPGALFNLYRYA
SGTERILVSQFDVPTIMEGGQFTVTAAANNQYTLDYPGMQQLKGTVGTLLKADTPEGPITLQIDHLAGKPGALFNLYRYA

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KLPTTIGLQSSLVLQERGKNSGIVNVSLQDTDPFKLTRVLNAVGEQYVKQNVERKAAEAQKTLAFLDVQLPLFKKQLEAS
KLPTTIGLQSSLVLQERGKNSGIVNVSLQDTDPFKLTRVLNAVGEQ                                  

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EEVYNRYRNQKGTVAFSEEAALILGQSVDRQTKLLDAQQRRRELESRFTSAHPAVQTLDNQIAALKSDMGSIQERIKGLP


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AIQQEAVRMERDVKVNTELYQSLLNNALQLRLVKEGKVGNVRVLDEAVVPTQPVKPNRKVIIAAALALGLFLGIVAAFIR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSFVEQRLRDPHEVEADTGLPVFSTIPLSPSQAAIAKRRLSGATGVRLLAIENPDDPAVESLRSLRTAMQFAMLESPNNR


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLISGPTPGVGKSFVTANFAALMAAAGKRTLLIDADLRRGHTHQYFGLQRHGGLSELIAGSLTVQQTVHRQVVPNLDFLA
   SGPTPGVGKSFVTANFAALMAAAGKRTLLIDADLRRGHTHQYFGLQRHGGLSELIAGSLTVQQTVHRQVVPNLDFLA
          GKS                 LLIDADLR                                          
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TGQLPPNPAELLVSDSFKTLLERLSEQYDLVVIDTPPVLVAADTSTVAAHVGTVLLVARADQSTMGELKESTRRLSMSGK
TGQLPPNPAELLVSDSFKTLLERLSEQYDLVVIDTPPVLVAADTSTVAAHVGTVLLVARADQSTMGELKESTRRLSMSGK
                              VVIDTPP                                           
       730       740       750       760
....:....|....:....|....:....|....:....|
AATGVLLNAMDLGRRTFAPYKYGRYRYTSYNYESILPEEQ
AATGVLLNAMDLGRRTFAPYKYGRYRYTSYNYESIL    
                   YKYGRYRYTSYNY        

© 1998-2019