BYKdb

Annotate results for A0A109K108

A0A109K108 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A109K108
DOMAINtad22/197LEQTVSSAIALIGRQYPVMIFVMCLCIGLAGVYLMTAPKRFTGTAVLLIDSRKMQGLQTQ
QPTGADTSIDSAMVDSQVEVLKSETIATNVIKQLHLLDSPEFTSDEPGLLGSVSNLFSWM
FPEQPPSEAALMRMAIGKLTGNLSIKRVGLSYVIEISYQSRSPDEAARIANAVADG
DOMAINcd607/799TSGLPNEGKSTVSEALAQTVAQSGSRTLLIDGDIRNPSLTARLAPSAQAGLIDVVVGRVD
WTDAVWIDPQTNLHFMPCVVTSRFSNSSDVLASPQMERLFQHLREHYDRIILDLSPLAPV
IDVRATGALADSYILVVEWAKAKVDILERVLSEAPVVRERMLGAVLNKVNMAVMSRYDIY
SAGYYRNRYYKRY
SITEWalker A614/616GKS
SITEWalker A'634/641LLIDGDIR
SITEWalker B716/722IILDLSP
SITEY Cluster783/801YDIYSAGYYRNRYYKRYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLQTRITPPREIESPTQESASLEQTVSSAIALIGRQYPVMIFVMCLCIGLAGVYLMTAPKRFTGTAVLLIDSRKMQGLQT
                     LEQTVSSAIALIGRQYPVMIFVMCLCIGLAGVYLMTAPKRFTGTAVLLIDSRKMQGLQT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QQPTGADTSIDSAMVDSQVEVLKSETIATNVIKQLHLLDSPEFTSDEPGLLGSVSNLFSWMFPEQPPSEAALMRMAIGKL
QQPTGADTSIDSAMVDSQVEVLKSETIATNVIKQLHLLDSPEFTSDEPGLLGSVSNLFSWMFPEQPPSEAALMRMAIGKL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TGNLSIKRVGLSYVIEISYQSRSPDEAARIANAVADGYINDSLESKYQASRRAAVWLQDRLKELRTEASTAERAVADFKA
TGNLSIKRVGLSYVIEISYQSRSPDEAARIANAVADG                                           

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KNNIVDAGGRLLTEQQLAEINSSLTQARSQRAEAQAKLERITAILNSDDGDSKVILNDLATVTDTMNNPVITKLRQTYLD


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YAAREADWSNRYGPTHLAVVNLRNQMREIRHSITDELRRTAEVYKSDLAIAKAREESSQKSLNDTIALSNGTNQAQIALR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLESNAQSARALSDNFLQLYMVSVQQQSFPITEARVITQASNAPNKTSPKTTLILLATLIGGAILAGGVAILLDMMDRVF


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RTVSQVEQFLHTSCLASIPAIGSEQNVRLAGHALLTKAGQLFNKRKKPQPAAPKPVPAAASGLPMDKSEVRSKHPQPHGD


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLLTADQSVGRYVINSPFSRFAEGFRSIKLACDLSSYGSANKVVGITSGLPNEGKSTVSEALAQTVAQSGSRTLLIDGDI
                                              TSGLPNEGKSTVSEALAQTVAQSGSRTLLIDGDI
                                                     GKS                 LLIDGDI
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RNPSLTARLAPSAQAGLIDVVVGRVDWTDAVWIDPQTNLHFMPCVVTSRFSNSSDVLASPQMERLFQHLREHYDRIILDL
RNPSLTARLAPSAQAGLIDVVVGRVDWTDAVWIDPQTNLHFMPCVVTSRFSNSSDVLASPQMERLFQHLREHYDRIILDL
R                                                                          IILDL
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SPLAPVIDVRATGALADSYILVVEWAKAKVDILERVLSEAPVVRERMLGAVLNKVNMAVMSRYDIYSAGYYRNRYYKRYG
SPLAPVIDVRATGALADSYILVVEWAKAKVDILERVLSEAPVVRERMLGAVLNKVNMAVMSRYDIYSAGYYRNRYYKRY 
SP                                                            YDIYSAGYYRNRYYKRYG
   
...
YVD

Y  

© 1998-2019