BYKdb

Annotate results for A0A109LPE3

A0A109LPE3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A109LPE3
DOMAINtad31/191FVLDLDRYFTEAKILKFWLGGIVIVCILVALIATLLATPQFRSSARIEVSQVAANVTALD
PLETQNQVSELQYLNTQYELLESRFMASRVLEAGNLSRDEEFLEVFALDESDEPLTVFAL
EGLLLEQLSVEPITQSSLIDVAFSSPSPGLSARIADLWAEE
DOMAINcd518/710TSTVPAEGKSMSATALATSFAQLGKRTLLIDADLRNSKLVKTLELGNHTSGGLAALLTNP
ASKLSDEVIPIVDLGFDYIPIGHRPPNPADLLSKPRLSELVDSVRGEYDQIVIDCAPLLS
LADAVETARAADGIVYVVEADRIKARIIETSMNRLKRSGTPIYGVVLTKLDERSAEYGYG
YGYGYGYGTTPED
SITEWalker A525/527GKS
SITEWalker A'545/552LLIDADLR
SITEWalker B628/634IVIDCAP
SITEY Cluster694/704YGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNSEANPRSFENHSGVETGTEVKMDEDRSSFVLDLDRYFTEAKILKFWLGGIVIVCILVALIATLLATPQFRSSARIEVS
                              FVLDLDRYFTEAKILKFWLGGIVIVCILVALIATLLATPQFRSSARIEVS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QVAANVTALDPLETQNQVSELQYLNTQYELLESRFMASRVLEAGNLSRDEEFLEVFALDESDEPLTVFALEGLLLEQLSV
QVAANVTALDPLETQNQVSELQYLNTQYELLESRFMASRVLEAGNLSRDEEFLEVFALDESDEPLTVFALEGLLLEQLSV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EPITQSSLIDVAFSSPSPGLSARIADLWAEEFIAANYEKRFGTNIEAREFLRDQIEELRETLSRSEQELVDYANANEILV
EPITQSSLIDVAFSSPSPGLSARIADLWAEE                                                 

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LESQASAEGSGTATQTLQAADLNAINRALAKAKTDRVEAQAAVAAGNVSNSTADNRVVTQLAIAEAELSVLEETFGPDYP


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EVQQKQSEVNSLRSSRSAEARAALRSAEMREKNLAAQLEDAKRSFLVQQNQGIQYGILKREVDTNRELYEALLQRLKELE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASGAGQNNITLIDQAEIPALPYSPSLLRNLLAGIVFGILLASALVYLRVTLSQAIRTAQDATSKLGVPVLGGIPMAQFDR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LADTLNQRSSEISEAYRSLRTNLVFLTPQGAPQVILLTSTVPAEGKSMSATALATSFAQLGKRTLLIDADLRNSKLVKTL
                                     TSTVPAEGKSMSATALATSFAQLGKRTLLIDADLRNSKLVKTL
                                            GKS                 LLIDADLR        
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELGNHTSGGLAALLTNPASKLSDEVIPIVDLGFDYIPIGHRPPNPADLLSKPRLSELVDSVRGEYDQIVIDCAPLLSLAD
ELGNHTSGGLAALLTNPASKLSDEVIPIVDLGFDYIPIGHRPPNPADLLSKPRLSELVDSVRGEYDQIVIDCAPLLSLAD
                                                                   IVIDCAP      
       650       660       670       680       690       700       710        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
AVETARAADGIVYVVEADRIKARIIETSMNRLKRSGTPIYGVVLTKLDERSAEYGYGYGYGYGYGTTPEDDAPEMATS
AVETARAADGIVYVVEADRIKARIIETSMNRLKRSGTPIYGVVLTKLDERSAEYGYGYGYGYGYGTTPED        
                                                     YGYGYGYGYGY              

© 1998-2019