BYKdb

Annotate results for A0A109MUB5

A0A109MUB5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A109MUB5
DOMAINcd47/225TSAEPNDGKSTTSANLAIVLAQEEKKVLLVDADLRKPSVHYAFSLSNIQGLTSVLTKKMS
IEKAVMKTAVPNLEILTSGPIPPNPSELLNSRAIEATIHHLKEMYDYIIFDTPPVLVVPD
SQIVANKCDGVIMVVSSGKTNKQSAVKAKELLTKANTTVLGVVLNGVETDNSNYYYYQS
SITE-184/-186GKT
SITEWalker A'74/81LLVDADLR
SITEWalker B154/160IIFDTPP
SITE-151/-153YDY
SITEY Cluster220/223YYYY
SITEWalker A54/56GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRSKDKKQVNLIAQNNPKSPITEQYRLIRTNIQFASVDEDIQTIVVTSAEPNDGKSTTSANLAIVLAQEEKKVLLVDADL
                                              TSAEPNDGKSTTSANLAIVLAQEEKKVLLVDADL
                                                     GKS                 LLVDADL
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKPSVHYAFSLSNIQGLTSVLTKKMSIEKAVMKTAVPNLEILTSGPIPPNPSELLNSRAIEATIHHLKEMYDYIIFDTPP
RKPSVHYAFSLSNIQGLTSVLTKKMSIEKAVMKTAVPNLEILTSGPIPPNPSELLNSRAIEATIHHLKEMYDYIIFDTPP
R                                                                        IIFDTPP
       170       180       190       200       210       220     
....:....|....:....|....:....|....:....|....:....|....:....|....:
VLVVPDSQIVANKCDGVIMVVSSGKTNKQSAVKAKELLTKANTTVLGVVLNGVETDNSNYYYYQS
VLVVPDSQIVANKCDGVIMVVSSGKTNKQSAVKAKELLTKANTTVLGVVLNGVETDNSNYYYYQS
                                                           YYYY  
© 1998-2019