BYKdb

Annotate results for A0A109MW30

A0A109MW30 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A109MW30
DOMAINcd45/224TSANPGEGKSTTSINVAAVFAQQGKRILIIDADLRKPSVHTNFNMENFLGLTNIITKQNQ
LQEAIQSSIYPNLDVLTSGPIPPNPSELLGSNGMENLLEEAKMNYDLVILDTPPVNAVTD
AQILANMTDGVVLVVSSGSTEIQQAKKAKELLQKADAKLLGAILNKKKQKYSDEYYYYGK
SITEWalker A52/54GKS
SITEWalker A'72/79LIIDADLR
SITEWalker B152/158VILDTPP
SITEY Cluster215/222YSDEYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTEAKKRSSISMLKSKSPVVEQYRTIRTNLQFSAVEKDIRSMIFTSANPGEGKSTTSINVAAVFAQQGKRILIIDADLRK
                                            TSANPGEGKSTTSINVAAVFAQQGKRILIIDADLRK
                                                   GKS                 LIIDADLR 
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PSVHTNFNMENFLGLTNIITKQNQLQEAIQSSIYPNLDVLTSGPIPPNPSELLGSNGMENLLEEAKMNYDLVILDTPPVN
PSVHTNFNMENFLGLTNIITKQNQLQEAIQSSIYPNLDVLTSGPIPPNPSELLGSNGMENLLEEAKMNYDLVILDTPPVN
                                                                       VILDTPP  
       170       180       190       200       210       220    
....:....|....:....|....:....|....:....|....:....|....:....|....
AVTDAQILANMTDGVVLVVSSGSTEIQQAKKAKELLQKADAKLLGAILNKKKQKYSDEYYYYGK
AVTDAQILANMTDGVVLVVSSGSTEIQQAKKAKELLQKADAKLLGAILNKKKQKYSDEYYYYGK
                                                      YSDEYYYY  
© 1998-2019