BYKdb

Annotate results for A0A109RC47

A0A109RC47 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A109RC47
DOMAINcd58/249TSSGPFEGKSTVAANVATTMADLDGVRVLMIDGDLRKPTVHKTFDLHSRRGLTTYLTDRT
VSYMDVCEYIPEVNLYVMPAGPLPPNPAELLSSKRMNDLLSDVSEVFDIVIIDAPPLLPV
TDAQIIASRTDATIFVLREGVATYSNVQKSKGLLDSVNARVIGAIYNGADVSAMDAYYGY
GYSDEEIELEEF
SITEWalker A65/67GKS
SITEWalker A'86/93LMIDGDLR
SITEWalker B167/173VIIDAPP
SITE-120/-126YMDVCEY
SITEY Cluster234/239YYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFNWKKRQMDKKNKVQRLGVGLMTVNDPNHVVSEQFRTIRTNIQFAVEEFQLKTLMFTSSGPFEGKSTVAANVATTMADL
                                                         TSSGPFEGKSTVAANVATTMADL
                                                                GKS             
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DGVRVLMIDGDLRKPTVHKTFDLHSRRGLTTYLTDRTVSYMDVCEYIPEVNLYVMPAGPLPPNPAELLSSKRMNDLLSDV
DGVRVLMIDGDLRKPTVHKTFDLHSRRGLTTYLTDRTVSYMDVCEYIPEVNLYVMPAGPLPPNPAELLSSKRMNDLLSDV
     LMIDGDLR                                                                   
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SEVFDIVIIDAPPLLPVTDAQIIASRTDATIFVLREGVATYSNVQKSKGLLDSVNARVIGAIYNGADVSAMDAYYGYGYS
SEVFDIVIIDAPPLLPVTDAQIIASRTDATIFVLREGVATYSNVQKSKGLLDSVNARVIGAIYNGADVSAMDAYYGYGYS
      VIIDAPP                                                            YYGYGY 
       250       
....:....|....:..
DEEIELEEFKSEEDHAL
DEEIELEEF        

© 1998-2019