BYKdb

Annotate results for A0A109UGJ1

A0A109UGJ1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A109UGJ1
DOMAINcd54/241TSSVAHEGKSTIAINLARSLAMAGNYVLLIDGDLRAPVIQKYLKITNNINNGLSSVLANK
IPAEEAIYKYPAMEIEIMFSGPIPPNAVELLSKGRAKRLIGELRERYDYIIIDSPPSGIV
TDAKVLSQSVDGLLYVVRQNFAEKDLIKRTTKDYIASGTNILGVVFNNFTQDNFARKRKF
NNYYSSED
SITEWalker A61/63GKS
SITEWalker A'81/88LLIDGDLR
SITEWalker B163/169IIIDSPP
SITE-121/-162YKYPAMEIEIMFSGPIPPNAVELLSKGRAKRLIGELRERYDY
SITEY Cluster236/237YY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFRKKVKKNKLNIFEGTHIIHDESPFAYLEGYKSLRTNLSFLTYGGEVKTILVTSSVAHEGKSTIAINLARSLAMAGNYV
                                                     TSSVAHEGKSTIAINLARSLAMAGNYV
                                                            GKS                 
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLIDGDLRAPVIQKYLKITNNINNGLSSVLANKIPAEEAIYKYPAMEIEIMFSGPIPPNAVELLSKGRAKRLIGELRERY
LLIDGDLRAPVIQKYLKITNNINNGLSSVLANKIPAEEAIYKYPAMEIEIMFSGPIPPNAVELLSKGRAKRLIGELRERY
LLIDGDLR                                                                        
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DYIIIDSPPSGIVTDAKVLSQSVDGLLYVVRQNFAEKDLIKRTTKDYIASGTNILGVVFNNFTQDNFARKRKFNNYYSSE
DYIIIDSPPSGIVTDAKVLSQSVDGLLYVVRQNFAEKDLIKRTTKDYIASGTNILGVVFNNFTQDNFARKRKFNNYYSSE
  IIIDSPP                                                                  YY   
 
.
D
D

© 1998-2019