BYKdb

Annotate results for A0A116JV85

A0A116JV85 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A116JV85
DOMAINcd41/230TSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMSGFFKPITKITGLTDYLAGTT
DLSRGLCETNIPNLTVIESGKISPNPTALLQSKNFENLLATLRRYFDYVIVDCPPLGMVI
DAAIIAQKCDAMVLVAEAGHVKRSAVKKVKEQLEQTGTPFLGVILNKYDIATEKYGDYGN
YGNYGNYGKK
SITEWalker A48/50GKS
SITEWalker A'68/75VLVDADIR
SITEWalker B149/155VIVDCPP
SITE-60/-65YARSGY
SITE-145/-148YFDY
SITEY Cluster215/227YGDYGNYGNYGNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
                                        TSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
                                               GKS                 VLVDADIR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GFFKPITKITGLTDYLAGTTDLSRGLCETNIPNLTVIESGKISPNPTALLQSKNFENLLATLRRYFDYVIVDCPPLGMVI
GFFKPITKITGLTDYLAGTTDLSRGLCETNIPNLTVIESGKISPNPTALLQSKNFENLLATLRRYFDYVIVDCPPLGMVI
                                                                    VIVDCPP     
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
DAAIIAQKCDAMVLVAEAGHVKRSAVKKVKEQLEQTGTPFLGVILNKYDIATEKYGDYGNYGNYGNYGKKA
DAAIIAQKCDAMVLVAEAGHVKRSAVKKVKEQLEQTGTPFLGVILNKYDIATEKYGDYGNYGNYGNYGKK 
                                                      YGDYGNYGNYGNY    
© 1998-2019