BYKdb

Annotate results for A0A117J2D7

A0A117J2D7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A117J2D7
DOMAINcd42/229TSVLPNEGKSTTVANLAIVMGQDNKKVLLIDCDLRKPVVHRRFELPNKGLTNCFAENIPL
YQVIRKNVFPNLDIVTSGPIPPNPAELLGSSRMMDLLEEVDEDYDYIFLDMPPVLVVTDA
AIMGSKVDGVVLVLASGEVSPEEARQAKSLLEKGKANILGVVLNKMPYTHRHSHYYYYYY
DEDHIKHK
SITEWalker A49/51GKS
SITEWalker A'69/76LLIDCDLR
SITEWalker B148/154IFLDMPP
SITE-145/-147YDY
SITEY Cluster216/221YYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAEIDFITQYDSRSPISEAYRSIRTNLQFSGAGQDLKAVAFTSVLPNEGKSTTVANLAIVMGQDNKKVLLIDCDLRKPVV
                                         TSVLPNEGKSTTVANLAIVMGQDNKKVLLIDCDLRKPVV
                                                GKS                 LLIDCDLR    
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HRRFELPNKGLTNCFAENIPLYQVIRKNVFPNLDIVTSGPIPPNPAELLGSSRMMDLLEEVDEDYDYIFLDMPPVLVVTD
HRRFELPNKGLTNCFAENIPLYQVIRKNVFPNLDIVTSGPIPPNPAELLGSSRMMDLLEEVDEDYDYIFLDMPPVLVVTD
                                                                   IFLDMPP      
       170       180       190       200       210       220       230  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
AAIMGSKVDGVVLVLASGEVSPEEARQAKSLLEKGKANILGVVLNKMPYTHRHSHYYYYYYDEDHIKHKHHK
AAIMGSKVDGVVLVLASGEVSPEEARQAKSLLEKGKANILGVVLNKMPYTHRHSHYYYYYYDEDHIKHK   
                                                       YYYYYY           
© 1998-2019