BYKdb

Annotate results for A0A117LAK6

A0A117LAK6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A117LAK6
DOMAINcd42/230TSSLPNEGKSTIVKNLSYSVALTGSKVIVIDADLRNPTVHKFNLSNSRGLTNLLIDEGDY
EAYLNVDTSYSNLHILTSGPIPPNPAELLGSNRMKKLLSSIQENYDYVFIDSPPVVTVTD
AVVLAPVVDGVILVIQAGKTEIGAVSRAKEILESVKANILGVVLNRVKESHGGYYYYYYY
DDNKPQHRK
SITE-179/-181GKT
SITEWalker A'69/76IVIDADLR
SITEWalker B149/155VFIDSPP
SITE-101/-148YEAYLNVDTSYSNLHILTSGPIPPNPAELLGSNRMKKLLSSIQENYDY
SITEY Cluster215/221YYYYYYY
SITEWalker A49/51GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVVARNPIVADPKSPFAEAFRALRTNLQFTSVDRKVKSILITSSLPNEGKSTIVKNLSYSVALTGSKVIVIDADLRNPTV
                                         TSSLPNEGKSTIVKNLSYSVALTGSKVIVIDADLRNPTV
                                                GKS                 IVIDADLR    
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HKFNLSNSRGLTNLLIDEGDYEAYLNVDTSYSNLHILTSGPIPPNPAELLGSNRMKKLLSSIQENYDYVFIDSPPVVTVT
HKFNLSNSRGLTNLLIDEGDYEAYLNVDTSYSNLHILTSGPIPPNPAELLGSNRMKKLLSSIQENYDYVFIDSPPVVTVT
                                                                    VFIDSPP     
       170       180       190       200       210       220       230    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
DAVVLAPVVDGVILVIQAGKTEIGAVSRAKEILESVKANILGVVLNRVKESHGGYYYYYYYDDNKPQHRKRRKR
DAVVLAPVVDGVILVIQAGKTEIGAVSRAKEILESVKANILGVVLNRVKESHGGYYYYYYYDDNKPQHRK    
                                                      YYYYYYY             
© 1998-2019