BYKdb

Annotate results for A0A118Q8H8

A0A118Q8H8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A118Q8H8
DOMAINtad1/253MVIKNAKLIVAVTVSFVVLGGLYAIVAKPIYGVDIVVQVESNGADMMGGAASGLVGGLST
LFDVKSTDDGEMEILQSRLVTEPVVDDQRLYIDARPDYFPLIGGVIARRSGKLSTPGLFG
IGGYVWGRESITVSAFDVPRDFWEDRFTVTALGGGRYRLSGGDLDDDAIGQIGVPLRVKT
AAGDVSLLVAAIEGRPNAQFVVRRFSKQKMLTRLQKDLTITEKGKDQSGVIGVKYESDDP
VLAAGVLNEIADN
DOMAINcd529/716TGPSAGIGKSFISANVAALLGQSNKRVLLIDGDLRRGHLAKEFGVRAQQGLSSVLRGEIK
VEDAIVRDVSAHVDFLPTGPRVGQPVELFLSNSLPGLLSDVSHRYDVVLLDAPPLLPVTD
ATVLASHAGTILLVARSGVTSQGEILESVKRIDRVGAKVSGVVFNCFSPGLRSAQYGNYG
AYAYEGAD
SITEWalker A536/538GKS
SITEWalker A'556/563LLIDGDLR
SITEWalker B636/642VLLDAPP
SITEY Cluster704/712YGNYGAYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVIKNAKLIVAVTVSFVVLGGLYAIVAKPIYGVDIVVQVESNGADMMGGAASGLVGGLSTLFDVKSTDDGEMEILQSRLV
MVIKNAKLIVAVTVSFVVLGGLYAIVAKPIYGVDIVVQVESNGADMMGGAASGLVGGLSTLFDVKSTDDGEMEILQSRLV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TEPVVDDQRLYIDARPDYFPLIGGVIARRSGKLSTPGLFGIGGYVWGRESITVSAFDVPRDFWEDRFTVTALGGGRYRLS
TEPVVDDQRLYIDARPDYFPLIGGVIARRSGKLSTPGLFGIGGYVWGRESITVSAFDVPRDFWEDRFTVTALGGGRYRLS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GGDLDDDAIGQIGVPLRVKTAAGDVSLLVAAIEGRPNAQFVVRRFSKQKMLTRLQKDLTITEKGKDQSGVIGVKYESDDP
GGDLDDDAIGQIGVPLRVKTAAGDVSLLVAAIEGRPNAQFVVRRFSKQKMLTRLQKDLTITEKGKDQSGVIGVKYESDDP

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLAAGVLNEIADNYVRQNANRKAATAEKSLQFLNAQIPEVEGQLRRVEDRLNAYQNKHEVVDLTEQAKAMLGQAVTAQTS
VLAAGVLNEIADN                                                                   

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LFELEQKRKALASVFTPEHPQLASLDQQIASAKANVSTFESAISRLPDAQQNVVRLRRDVTVQTEIYVGLLNSIQQLRLA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TASKIGNVRVIDHAIVPDEPLRPKPVLVVVLAAVVGLLVGVCVAIARAVLYGGVTDPSEIERDAELDVIATIPQSPSQRR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTAVGAGAGGTVLSLARPHEPAVEALRSLCTAMQFLLLDRPKNNLVLITGPSAGIGKSFISANVAALLGQSNKRVLLIDG
                                                TGPSAGIGKSFISANVAALLGQSNKRVLLIDG
                                                       GKS                 LLIDG
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLRRGHLAKEFGVRAQQGLSSVLRGEIKVEDAIVRDVSAHVDFLPTGPRVGQPVELFLSNSLPGLLSDVSHRYDVVLLDA
DLRRGHLAKEFGVRAQQGLSSVLRGEIKVEDAIVRDVSAHVDFLPTGPRVGQPVELFLSNSLPGLLSDVSHRYDVVLLDA
DLR                                                                        VLLDA
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PPLLPVTDATVLASHAGTILLVARSGVTSQGEILESVKRIDRVGAKVSGVVFNCFSPGLRSAQYGNYGAYAYEGADVARR
PPLLPVTDATVLASHAGTILLVARSGVTSQGEILESVKRIDRVGAKVSGVVFNCFSPGLRSAQYGNYGAYAYEGAD    
PP                                                             YGNYGAYAY        
    
....
VDQT


© 1998-2019