BYKdb

Annotate results for A0A120CU25

A0A120CU25 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A120CU25
DOMAINtad50/227PATNLREYWRIANKRKWLILGVTGAFFVMGIIISLMMTPLYTATVRLQIDRNVAKVVDGG
NVTPLEGTDIEFLKTQYELLQSRGLAERVVVALKLGDSEAFQGSRGPSLLGSLLGMLSSS
GDTPTKGNQRAERERRSIDLVLQSRSVRPIAGSRLVDVSFTDPDPVMAQRIATALASA
DOMAINcd561/750TSAGPAEGKSITAMAIARHFANMGLKVLLVDGDMRNPSLHKKMAIPNGAGLSSYLAGACA
PPDTFQATDIATLAFMSSGPLPPSAADLLAGPRLHSLLRVGLEVFDLIVIDAPPVMGMAD
ASILANTVEATVFVVGAGQSTSGQIGAVLKRLRLGHPSLIGAVLTKFDAVAEGYGYGYGY
DYNYGVDQKL
SITEWalker A568/570GKS
SITEWalker A'588/595LLVDGDMR
SITEWalker B668/674IVIDAPP
SITEY Cluster734/744YGYGYGYDYNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTHNENVPAGDDRRPSNIAPIQQAQRPAFAGYADAGYPNYSDAAILQAEPATNLREYWRIANKRKWLILGVTGAFFVMGI
                                                 PATNLREYWRIANKRKWLILGVTGAFFVMGI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IISLMMTPLYTATVRLQIDRNVAKVVDGGNVTPLEGTDIEFLKTQYELLQSRGLAERVVVALKLGDSEAFQGSRGPSLLG
IISLMMTPLYTATVRLQIDRNVAKVVDGGNVTPLEGTDIEFLKTQYELLQSRGLAERVVVALKLGDSEAFQGSRGPSLLG

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLLGMLSSSGDTPTKGNQRAERERRSIDLVLQSRSVRPIAGSRLVDVSFTDPDPVMAQRIATALASAYSDSNLDKRFQAN
SLLGMLSSSGDTPTKGNQRAERERRSIDLVLQSRSVRPIAGSRLVDVSFTDPDPVMAQRIATALASA             

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VYAKTFLEDQVKQLKLRLEESEKQLLDFAQKEQIVAVSEKASIAENNLASANAALGVLVSERIKSEQLWRQVENASQINM


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PQLLSNKVIEGLRDQRNLLATEYQEKLETFKPGYPAMVQIQNKVDEIDRQLSVEIQTIKDSLKAGFASAAAQEEEMKKQI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EQLRVEALDLQKRSIRYNILKREVDTNRGLYEGLLQRHKEVDVAGGVGANNIFIVDRAEVPIAPSSPKLVRSILLSLLLG


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGVGVGAAVLQEMMDDSVRNIDDLERVTGLPSLGVIPKVLREPVEAEFADPRSPVMEAYRSLCTSLQLTTASGLPKSLAV


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TSAGPAEGKSITAMAIARHFANMGLKVLLVDGDMRNPSLHKKMAIPNGAGLSSYLAGACAPPDTFQATDIATLAFMSSGP
TSAGPAEGKSITAMAIARHFANMGLKVLLVDGDMRNPSLHKKMAIPNGAGLSSYLAGACAPPDTFQATDIATLAFMSSGP
       GKS                 LLVDGDMR                                             
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LPPSAADLLAGPRLHSLLRVGLEVFDLIVIDAPPVMGMADASILANTVEATVFVVGAGQSTSGQIGAVLKRLRLGHPSLI
LPPSAADLLAGPRLHSLLRVGLEVFDLIVIDAPPVMGMADASILANTVEATVFVVGAGQSTSGQIGAVLKRLRLGHPSLI
                           IVIDAPP                                              
       730       740       750       760  
....:....|....:....|....:....|....:....|..
GAVLTKFDAVAEGYGYGYGYDYNYGVDQKLSAGDHSVPRLGG
GAVLTKFDAVAEGYGYGYGYDYNYGVDQKL            
             YGYGYGYDYNY                  

© 1998-2019