BYKdb

Annotate results for A0A120IAT4

A0A120IAT4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A120IAT4
DOMAINcd58/243TSSGPFEGKSMTTANLAAVMADQDMRVLLVDADMRKPTVQKTFDIHTTEGLTSLLTERDK
QPMDVIKYVPETNVYVLTAGPKPPNPAELLSSQRMKDIFEELKTIFDLIIFDTPPVLAVT
DAQIIANMVDGVVMVVRQNVAQVDNLHKAKQLLEKAQANVLGVVYNGIENSKDAAYGYGY
GYGVDE
SITEWalker A65/67GKS
SITEWalker A'85/92LLVDADMR
SITEWalker B166/172IIFDTPP
SITEY Cluster233/239YGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFNRKAKKIEALNAEQKKGASLITVTKPNNPVSEMYRTLRTNIQFSVVDSELKSMMVTSSGPFEGKSMTTANLAAVMADQ
                                                         TSSGPFEGKSMTTANLAAVMADQ
                                                                GKS             
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DMRVLLVDADMRKPTVQKTFDIHTTEGLTSLLTERDKQPMDVIKYVPETNVYVLTAGPKPPNPAELLSSQRMKDIFEELK
DMRVLLVDADMRKPTVQKTFDIHTTEGLTSLLTERDKQPMDVIKYVPETNVYVLTAGPKPPNPAELLSSQRMKDIFEELK
    LLVDADMR                                                                    
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TIFDLIIFDTPPVLAVTDAQIIANMVDGVVMVVRQNVAQVDNLHKAKQLLEKAQANVLGVVYNGIENSKDAAYGYGYGYG
TIFDLIIFDTPPVLAVTDAQIIANMVDGVVMVVRQNVAQVDNLHKAKQLLEKAQANVLGVVYNGIENSKDAAYGYGYGYG
     IIFDTPP                                                            YGYGYGY 
   
...
VDE
VDE

© 1998-2019