BYKdb

Annotate results for A0A120LLF8

A0A120LLF8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A120LLF8
DOMAINcd37/213TSGESGTGKSTVSANLAVAYAQKGNRTLLIDADLRKPTQHYLFSQEMHVGLSNYIRRDIS
IESCVQQVILEDCEFSIITSGAIMSNPNDLLASSKMTAALQEVKQLYDVVIIDTPPVNVV
SDALILAKKVDGVLLVIHADKTNKQSAKNAVKKLRLVNANILGVVANGTDTGENYYY
SITEWalker A44/46GKS
SITEWalker A'64/71LLIDADLR
SITEWalker B146/152VIIDTPP
SITEY Cluster211/213YYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRSMKENYSIISEQVKLIRENVDYLCQQQDAQTILITSGESGTGKSTVSANLAVAYAQKGNRTLLIDADLRKPTQHYLFS
                                    TSGESGTGKSTVSANLAVAYAQKGNRTLLIDADLRKPTQHYLFS
                                           GKS                 LLIDADLR         
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QEMHVGLSNYIRRDISIESCVQQVILEDCEFSIITSGAIMSNPNDLLASSKMTAALQEVKQLYDVVIIDTPPVNVVSDAL
QEMHVGLSNYIRRDISIESCVQQVILEDCEFSIITSGAIMSNPNDLLASSKMTAALQEVKQLYDVVIIDTPPVNVVSDAL
                                                                 VIIDTPP        
       170       180       190       200       210   
....:....|....:....|....:....|....:....|....:....|...
ILAKKVDGVLLVIHADKTNKQSAKNAVKKLRLVNANILGVVANGTDTGENYYY
ILAKKVDGVLLVIHADKTNKQSAKNAVKKLRLVNANILGVVANGTDTGENYYY
                                                  YYY
© 1998-2019