BYKdb

Annotate results for A0A124JWU0

A0A124JWU0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A124JWU0
DOMAINtad1/169MSFDIREIIAIIRANLVVIVIIVAASLTIATVVTMLQTPRYTAETTIQINDQSAQVLGKQ
NDTMQDPVVVASDTERFLQTQVDILKSRALAERVAQKLRLIGNPKFYDAMGIRRPSGDIS
KEKLEDVTINAIDAARGVDLPRKTRLATVSFNSTQPELAAQIANAFASE
DOMAINcd514/709TSSQPSEGKSTTCYAVAAGIARLGRRVVLLDVDLRRPALHRSIASLNGDNSQGVSSILTA
QCSIDDAIRKTDVENLDVVTSGPIPPSPTELLSSIAMHQLIDDLSKRYDLVLIDSPPVLG
LADAPVLAALVESVVVVIQSDRSRRGSLKASLRRLRSMRSNIIGGVLTKFDPTDTGNRYS
EYYGYSYYQYSNSSTS
SITEWalker A521/523GKS
SITEWalker A'541/548VLLDVDLR
SITEWalker B624/630VLIDSPP
SITEY Cluster692/703YSEYYGYSYYQY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSFDIREIIAIIRANLVVIVIIVAASLTIATVVTMLQTPRYTAETTIQINDQSAQVLGKQNDTMQDPVVVASDTERFLQT
MSFDIREIIAIIRANLVVIVIIVAASLTIATVVTMLQTPRYTAETTIQINDQSAQVLGKQNDTMQDPVVVASDTERFLQT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QVDILKSRALAERVAQKLRLIGNPKFYDAMGIRRPSGDISKEKLEDVTINAIDAARGVDLPRKTRLATVSFNSTQPELAA
QVDILKSRALAERVAQKLRLIGNPKFYDAMGIRRPSGDISKEKLEDVTINAIDAARGVDLPRKTRLATVSFNSTQPELAA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QIANAFASEYIQTNLQRRFDSSAYAREFISGQLYEARAKLEQSERELNAYAREAGIIRDRDGSSDGSGSGGAGSSVTTKS
QIANAFASE                                                                       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLEVNTAANQAEAARIAAEQRWRLISGSSALNSTEVLANPAITSLLADRARVTAELEKQRASHLEDYPAVLQLKAQVGVI


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAQINSLAHSISLSVKQQYDAARQLERSLKSEVMRLKGSSLEEQDRLVRYRILEREADTNRTVYEGLLQRFKELNAAAGI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVSNISIIDPAIAPIRPTSPNLFRNLLLAMLAGLSIAAVFVYLRTQLDDTVKVPEDVEGKLQMPLLGVIPLVPELDLDLA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLDPKSPISEGHNSLRSALLYSTSSGLPKTMLITSSQPSEGKSTTCYAVAAGIARLGRRVVLLDVDLRRPALHRSIASLN
                                 TSSQPSEGKSTTCYAVAAGIARLGRRVVLLDVDLRRPALHRSIASLN
                                        GKS                 VLLDVDLR            
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GDNSQGVSSILTAQCSIDDAIRKTDVENLDVVTSGPIPPSPTELLSSIAMHQLIDDLSKRYDLVLIDSPPVLGLADAPVL
GDNSQGVSSILTAQCSIDDAIRKTDVENLDVVTSGPIPPSPTELLSSIAMHQLIDDLSKRYDLVLIDSPPVLGLADAPVL
                                                               VLIDSPP          
       650       660       670       680       690       700         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
AALVESVVVVIQSDRSRRGSLKASLRRLRSMRSNIIGGVLTKFDPTDTGNRYSEYYGYSYYQYSNSSTS
AALVESVVVVIQSDRSRRGSLKASLRRLRSMRSNIIGGVLTKFDPTDTGNRYSEYYGYSYYQYSNSSTS
                                                   YSEYYGYSYYQY      

© 1998-2019