BYKdb

Annotate results for A0A126PFG0

A0A126PFG0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A126PFG0
DOMAINtad19/254QPLNLRAVLARYRYHWSLFVAGVALALLGAYLYTQLVQPAYEVRASLLVEGEKKTPAEKS
ALQELDLVTTPKVVESEMEILKSRKLMLSVVRDLQLSTLYQQRDHLGARDLYGRSPVQFT
LVPTHSVPRQHVLDIVLKDQTSFYMAATNGNLTAHPFGRPVSDSIGTWQLTPVPAFALPA
GSRLRIVARDPDLVVTAYQKALEVDLINKISPAISLQIKDEVPQRGMDVLNQLMAV
DOMAINcd586/771TSSVSGEGKSFVSAHLAISLAGTGQRTVLVDLDLRRPGMAKLFGLANDHAGVSDFLTERA
AWPAIVQPTTVSPNLNLIASGTFPVADLLEGPRLGELLTGLRGAFHHVVLDSPPLHLVAD
ALLLAQASDLTLYVVRQGVTDQDELAFIEELNRQGSLPKLHLIFNGIDSRRYGYGYAYER
RYLKSA
SITEWalker A593/595GKS
SITEWalker A'613/620VLVDLDLR
SITEWalker B693/699VVLDSPP
SITEY Cluster757/767YGYGYAYERRY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEPFNGQVSTFYTAATASQPLNLRAVLARYRYHWSLFVAGVALALLGAYLYTQLVQPAYEVRASLLVEGEKKTPAEKSAL
                  QPLNLRAVLARYRYHWSLFVAGVALALLGAYLYTQLVQPAYEVRASLLVEGEKKTPAEKSAL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QELDLVTTPKVVESEMEILKSRKLMLSVVRDLQLSTLYQQRDHLGARDLYGRSPVQFTLVPTHSVPRQHVLDIVLKDQTS
QELDLVTTPKVVESEMEILKSRKLMLSVVRDLQLSTLYQQRDHLGARDLYGRSPVQFTLVPTHSVPRQHVLDIVLKDQTS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FYMAATNGNLTAHPFGRPVSDSIGTWQLTPVPAFALPAGSRLRIVARDPDLVVTAYQKALEVDLINKISPAISLQIKDEV
FYMAATNGNLTAHPFGRPVSDSIGTWQLTPVPAFALPAGSRLRIVARDPDLVVTAYQKALEVDLINKISPAISLQIKDEV

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PQRGMDVLNQLMAVYNGAATAAKNKLTANTLHFIDSRLASLRGELSQAEADEAGYRSQQGLTDIASQSKVYLENAQANDS
PQRGMDVLNQLMAV                                                                  

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLNEAQVQLAVVSTIERTLRDPRPTATVPTALGITDATLSSLVEKLTELHAQRERLLTTTPENNPLFNPLNSEILATQLA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IRSSVKNIKASLLATVRELESFNSRFESSIKRVPGQERQLVGKKRQLTIKENLYTYLLQKREEASLSYAATLDDARIIDS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AYVLPSKWPNRWLLYAVAAAVGLVVPAALLQVKDALSNKITTRAEIERATRAPVLAELAFEKEPGPGPMVGPLPATSVLA


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EQVRGLRTRLPALLPDQPAGRVVLVTSSVSGEGKSFVSAHLAISLAGTGQRTVLVDLDLRRPGMAKLFGLANDHAGVSDF
                         TSSVSGEGKSFVSAHLAISLAGTGQRTVLVDLDLRRPGMAKLFGLANDHAGVSDF
                                GKS                 VLVDLDLR                    
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTERAAWPAIVQPTTVSPNLNLIASGTFPVADLLEGPRLGELLTGLRGAFHHVVLDSPPLHLVADALLLAQASDLTLYVV
LTERAAWPAIVQPTTVSPNLNLIASGTFPVADLLEGPRLGELLTGLRGAFHHVVLDSPPLHLVADALLLAQASDLTLYVV
                                                    VVLDSPP                     
       730       740       750       760       770 
....:....|....:....|....:....|....:....|....:....|.
RQGVTDQDELAFIEELNRQGSLPKLHLIFNGIDSRRYGYGYAYERRYLKSA
RQGVTDQDELAFIEELNRQGSLPKLHLIFNGIDSRRYGYGYAYERRYLKSA
                                    YGYGYAYERRY    

© 1998-2019