BYKdb

Annotate results for A0A126SX27

A0A126SX27 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A126SX27
DOMAINtad8/150SGITFADIVVIIRKHIATAAICFAVIVGVAGAYAFLAAPQYSATAQVIATYNAAQDGGNS
DDITQQNTGGTYVSNQIKSYPTLATTETVLKPVISQLGLDVSVKDLSNQLTVSNPSNTAF
VNITATAGDAKQSATIANAVADS
DOMAINcd284/472SSTSPSEGKTTTAVNAAAVLAENGAKVLLIDADLRHPSVAHHLGIEGNVGLAHVLSGQMA
PVDVVQNYWKPNLHILPAGKRPANASLLLNSDMMKMLVDQALLQYDYVIIDTAPLTVSND
AIVFGSWTSGIVLVTARGLCRKKNLEEVADSLRTAKVPVLGFVFNFANPKKSHNEAYYYY
YEDGAKRSA
SITEWalker A291/293GKT
SITEWalker A'311/318LLIDADLR
SITEWalker B391/397VIIDTAP
SITE-388/-390YDY
SITEY Cluster460/464YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSDGSRPSGITFADIVVIIRKHIATAAICFAVIVGVAGAYAFLAAPQYSATAQVIATYNAAQDGGNSDDITQQNTGGTYV
       SGITFADIVVIIRKHIATAAICFAVIVGVAGAYAFLAAPQYSATAQVIATYNAAQDGGNSDDITQQNTGGTYV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SNQIKSYPTLATTETVLKPVISQLGLDVSVKDLSNQLTVSNPSNTAFVNITATAGDAKQSATIANAVADSLRTIVEHDLY
SNQIKSYPTLATTETVLKPVISQLGLDVSVKDLSNQLTVSNPSNTAFVNITATAGDAKQSATIANAVADS          

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKGAAAPIKLTVVQRAATPQEPSAPNKKLCIAAGVVLGLIVGIIAALLKDLLRTKVEEASDVRGIVHASALGSIPKNEAL


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EGTRPVIITEPNGSVTEEYRRIRTNIKFLEVNKTPGQGQLLVISSTSPSEGKTTTAVNAAAVLAENGAKVLLIDADLRHP
                                           SSTSPSEGKTTTAVNAAAVLAENGAKVLLIDADLRHP
                                                  GKT                 LLIDADLR  
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVAHHLGIEGNVGLAHVLSGQMAPVDVVQNYWKPNLHILPAGKRPANASLLLNSDMMKMLVDQALLQYDYVIIDTAPLTV
SVAHHLGIEGNVGLAHVLSGQMAPVDVVQNYWKPNLHILPAGKRPANASLLLNSDMMKMLVDQALLQYDYVIIDTAPLTV
                                                                      VIIDTAP   
       410       420       430       440       450       460       470         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
SNDAIVFGSWTSGIVLVTARGLCRKKNLEEVADSLRTAKVPVLGFVFNFANPKKSHNEAYYYYYEDGAKRSAARRGRKH
SNDAIVFGSWTSGIVLVTARGLCRKKNLEEVADSLRTAKVPVLGFVFNFANPKKSHNEAYYYYYEDGAKRSA       
                                                           YYYYY               
© 1998-2019