BYKdb

Annotate results for A0A126SYB4

A0A126SYB4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A126SYB4
DOMAINtad47/190EGMTLMDLIRIVGKHMFTAILVFVLVVVGVTAYTLTAQKKYMATAQLFASYNNTTADALD
SSVSSQSAAGTYIATQLKSYPGLVKTEAVLQPVIDELNDNSITTDDLATMVTATNPTDTY
MLNVSVEATNPEQSAQLANEVSQS
DOMAINcd324/513TSSMPSEGKTTVSCNLAAALAENGASVLLIDADLRHPSVAKRLGLEGGVGLAHVLSNQAS
VKDVVQRYWKPNLHIMPAGPRIQNASVLLNSRIMHELVHQAVQQYDYVIIDTTPMSVAND
AAVFGQMGNGVVMVSARGVTYKSALRGVVNELRDLDVPLLGYVFNLADEKRNRGYGNYYY
YGAYYKGEYG
SITEWalker A331/333GKT
SITEWalker A'351/358LLIDADLR
SITEWalker B431/437VIIDTTP
SITE-428/-430YDY
SITEY Cluster498/512YGNYYYYGAYYKGEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MIETVRQERSVAEDKAQQNSILIPENRIDANPQNVVLAERSESDADEGMTLMDLIRIVGKHMFTAILVFVLVVVGVTAYT
                                              EGMTLMDLIRIVGKHMFTAILVFVLVVVGVTAYT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTAQKKYMATAQLFASYNNTTADALDSSVSSQSAAGTYIATQLKSYPGLVKTEAVLQPVIDELNDNSITTDDLATMVTAT
LTAQKKYMATAQLFASYNNTTADALDSSVSSQSAAGTYIATQLKSYPGLVKTEAVLQPVIDELNDNSITTDDLATMVTAT

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NPTDTYMLNVSVEATNPEQSAQLANEVSQSLSRVVSSELYASGKKSMVKLSVVQKAKTPTSQSSPNTKLNIAVAVVAGIV
NPTDTYMLNVSVEATNPEQSAQLANEVSQS                                                  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGIFAALVRDLLARKLQDLMDLQSIDPNGSIAGIIPKDEVLNVTKPVIVTKPDSPIAEEFRRMRTNLSFVTSKDGDKGRL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IVITSSMPSEGKTTVSCNLAAALAENGASVLLIDADLRHPSVAKRLGLEGGVGLAHVLSNQASVKDVVQRYWKPNLHIMP
   TSSMPSEGKTTVSCNLAAALAENGASVLLIDADLRHPSVAKRLGLEGGVGLAHVLSNQASVKDVVQRYWKPNLHIMP
          GKT                 LLIDADLR                                          
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGPRIQNASVLLNSRIMHELVHQAVQQYDYVIIDTTPMSVANDAAVFGQMGNGVVMVSARGVTYKSALRGVVNELRDLDV
AGPRIQNASVLLNSRIMHELVHQAVQQYDYVIIDTTPMSVANDAAVFGQMGNGVVMVSARGVTYKSALRGVVNELRDLDV
                              VIIDTTP                                           
       490       500       510       520       530 
....:....|....:....|....:....|....:....|....:....|.
PLLGYVFNLADEKRNRGYGNYYYYGAYYKGEYGKEDSKKGRKRRRSHRRGK
PLLGYVFNLADEKRNRGYGNYYYYGAYYKGEYG                  
                 YGNYYYYGAYYKGEY                   
© 1998-2019