BYKdb

Annotate results for A0A126T702

A0A126T702 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A126T702
DOMAINtad23/285PSVSIRDYVDLLIEGRKTIFIALCSVLLVTTVYLVLAPRTYKADALLRIDKNKALLSATL
RSENNQAPAEAESPRAQREVEILRSRSVLGKVVDNLNLTIETEPYFFPLIGETLARRHDA
HDGIADAWWGFSRWAWGGEKLKIAAFSVPDRYLEKQFTLIALEDGRFQLLDPRGDELLAG
QVGEVLSAEIGEKTPVTIKVETLEAHPGTHFELTRRTALSAIETLQKAFAVKEVSKDTDI
LSVELKGRDPEQLAKSVNDIAAI
DOMAINcd561/747SSPAPGMGKSFVSANLAALLASIKKRVLVIDADMRNGRLHDTFSIGKQPGLSDLLAGRAT
LGEVIVSLPDVGIDLIPRGNMVLNPAELLVLGELSETLEQLKSFYNHIVIDSPPILGATD
AAILGKHADATFLVVKEGRYTAQELEVSARRFQQVGIKPNGFIINDMKEGSSYYPYYGYA
YQRADQE
SITEWalker A568/570GKS
SITEWalker A'588/595LVIDADMR
SITEWalker B668/674IVIDSPP
SITEY Cluster733/741YYPYYGYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MIYSQNEATPVLQTVNQARMAEPSVSIRDYVDLLIEGRKTIFIALCSVLLVTTVYLVLAPRTYKADALLRIDKNKALLSA
                      PSVSIRDYVDLLIEGRKTIFIALCSVLLVTTVYLVLAPRTYKADALLRIDKNKALLSA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TLRSENNQAPAEAESPRAQREVEILRSRSVLGKVVDNLNLTIETEPYFFPLIGETLARRHDAHDGIADAWWGFSRWAWGG
TLRSENNQAPAEAESPRAQREVEILRSRSVLGKVVDNLNLTIETEPYFFPLIGETLARRHDAHDGIADAWWGFSRWAWGG

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EKLKIAAFSVPDRYLEKQFTLIALEDGRFQLLDPRGDELLAGQVGEVLSAEIGEKTPVTIKVETLEAHPGTHFELTRRTA
EKLKIAAFSVPDRYLEKQFTLIALEDGRFQLLDPRGDELLAGQVGEVLSAEIGEKTPVTIKVETLEAHPGTHFELTRRTA

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSAIETLQKAFAVKEVSKDTDILSVELKGRDPEQLAKSVNDIAAIYVNATVNWESAEASQKLGFLESQLPIVKERLEKAE
LSAIETLQKAFAVKEVSKDTDILSVELKGRDPEQLAKSVNDIAAI                                   

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QGLSAYRQQHGAVDISAEAEILLKQASDMETLGIQLKQKYDEQSQRLESEHPDMISTNAQIKRVNNKLAALEKRIKDLPK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TQQNMVSLSRDVQVNTELYTSLLNSAQEQRIAAAGSLGNSRIVDFAVTPEKPYWPKPSLLLAIAGLLGLSLGSALIFLRH


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLQRHDNYPALLEYQVGLPLFAAIPHSKKQHKLGRLLGKDKDNGILVSQDPLDISVESLRGLRTTLEATLAQHESKVIMV


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSPAPGMGKSFVSANLAALLASIKKRVLVIDADMRNGRLHDTFSIGKQPGLSDLLAGRATLGEVIVSLPDVGIDLIPRGN
SSPAPGMGKSFVSANLAALLASIKKRVLVIDADMRNGRLHDTFSIGKQPGLSDLLAGRATLGEVIVSLPDVGIDLIPRGN
       GKS                 LVIDADMR                                             
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVLNPAELLVLGELSETLEQLKSFYNHIVIDSPPILGATDAAILGKHADATFLVVKEGRYTAQELEVSARRFQQVGIKPN
MVLNPAELLVLGELSETLEQLKSFYNHIVIDSPPILGATDAAILGKHADATFLVVKEGRYTAQELEVSARRFQQVGIKPN
                           IVIDSPP                                              
       730       740       750       760       770       780    
....:....|....:....|....:....|....:....|....:....|....:....|....
GFIINDMKEGSSYYPYYGYAYQRADQEPKDESSWSDKYQAVGDWLGKQLDRELLPVPAESDERV
GFIINDMKEGSSYYPYYGYAYQRADQE                                     
            YYPYYGYAY                                           

© 1998-2019