BYKdb

Annotate results for A0A127A501

A0A127A501 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A127A501
DOMAINtad11/147QGMSLTDYLRIARRFWKGIVALVLVSTVAAFGWYLIQPRIYSAEASGMVISSGADNLSWS
LAGDSLAKSKAKSYKAVAESASVADRVISDLSLPTTAQDLLGNVAVTVPTDGTEIRIDAR
DKDPVQSQKVANDWVKA
DOMAINcd282/470TSSLPSEGKSTVIANLASTLAADAEPVIVVDADLRRPNVHNVFDIVGDVGVTDILSGRAR
IDDVMQTWHRNDLVRVLAAGHIPPNPSELLGSQAMRNLLATLSQDALVLVDAPPLLPFTD
AAVLSRAADGTLVLVRANRTKVDELSHALGNLQRVKGRVLGLILNGIPAKGADARARGYY
GRYGYGEPP
SITEWalker A289/291GKS
SITEWalker A'309/316IVVDADLR
SITEWalker B389/395VLVDAPP
SITEY Cluster460/466YYGRYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEQGTGLSAEQGMSLTDYLRIARRFWKGIVALVLVSTVAAFGWYLIQPRIYSAEASGMVISSGADNLSWSLAGDSLAKSK
          QGMSLTDYLRIARRFWKGIVALVLVSTVAAFGWYLIQPRIYSAEASGMVISSGADNLSWSLAGDSLAKSK

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKSYKAVAESASVADRVISDLSLPTTAQDLLGNVAVTVPTDGTEIRIDARDKDPVQSQKVANDWVKALASQVSDLEKDAN
AKSYKAVAESASVADRVISDLSLPTTAQDLLGNVAVTVPTDGTEIRIDARDKDPVQSQKVANDWVKA             

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SNAKGNPAVKVVPLVTAMVPTEPVSPKLTLALGVGVVGGLLLGLAYAFIRDRVDRRIRTSEEAERFGYPVIGTLPLDDVL


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VKGSSVLEGTGGHQFMSEALRELRTNLRFIDVDHQPRIVLVTSSLPSEGKSTVIANLASTLAADAEPVIVVDADLRRPNV
                                         TSSLPSEGKSTVIANLASTLAADAEPVIVVDADLRRPNV
                                                GKS                 IVVDADLR    
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HNVFDIVGDVGVTDILSGRARIDDVMQTWHRNDLVRVLAAGHIPPNPSELLGSQAMRNLLATLSQDALVLVDAPPLLPFT
HNVFDIVGDVGVTDILSGRARIDDVMQTWHRNDLVRVLAAGHIPPNPSELLGSQAMRNLLATLSQDALVLVDAPPLLPFT
                                                                    VLVDAPP     
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAAVLSRAADGTLVLVRANRTKVDELSHALGNLQRVKGRVLGLILNGIPAKGADARARGYYGRYGYGEPPAEDRTLEPAA
DAAVLSRAADGTLVLVRANRTKVDELSHALGNLQRVKGRVLGLILNGIPAKGADARARGYYGRYGYGEPP          
                                                           YYGRYGY              
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QPREARSRRGSAGSAEDWSGSGQSMTDDAAGSRWDRPFDEDSQGAHGFGAPSPGQDRLGLAAEHDQPDGPRGHSGWAQPG


       570       580       590        
....:....|....:....|....:....|....:...
YGEDPGAHSTDADESAADDGVWLPARVRESYGSRRRGL


© 1998-2019