BYKdb

Annotate results for A0A127AL56

A0A127AL56 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A127AL56
DOMAINcd91/273TSSVPLEGKTTVAVNLAISIAQGVKEHVLLVDCDFRKPEIHKLFNLSPQRGLSDYLLGQV
TIPEILLKTKTPKLSVLPSGKQVSNPADLLASERMKELIQELKNRYNDRYIIFDSSPLQL
TSETMVLLSQVEGVILVVRAGKTNRNLVLNTIKEIEKERLLGVVLNGVEKSLTNKYYSHY
KYY
SITE-231/-233GKT
SITEWalker A'119/126LLVDCDFR
SITEWalker B201/207IIFDSSP
SITE-196/-200YNDRY
SITEY Cluster266/273YYSHYKYY
SITEWalker A98/100GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGKIHDALEKAERERYLINRSLPKSTPKRESGVENIEVQAPTLPKAEKDIIKKKKGYYKDTYALATEQFRILKSKILYVK


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NGTPPKTILVTSSVPLEGKTTVAVNLAISIAQGVKEHVLLVDCDFRKPEIHKLFNLSPQRGLSDYLLGQVTIPEILLKTK
          TSSVPLEGKTTVAVNLAISIAQGVKEHVLLVDCDFRKPEIHKLFNLSPQRGLSDYLLGQVTIPEILLKTK
                 GKT                  LLVDCDFR                                  
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TPKLSVLPSGKQVSNPADLLASERMKELIQELKNRYNDRYIIFDSSPLQLTSETMVLLSQVEGVILVVRAGKTNRNLVLN
TPKLSVLPSGKQVSNPADLLASERMKELIQELKNRYNDRYIIFDSSPLQLTSETMVLLSQVEGVILVVRAGKTNRNLVLN
                                        IIFDSSP                                 
       250       260       270   
....:....|....:....|....:....|...
TIKEIEKERLLGVVLNGVEKSLTNKYYSHYKYY
TIKEIEKERLLGVVLNGVEKSLTNKYYSHYKYY
                         YYSHYKYY
© 1998-2019