BYKdb

Annotate results for A0A127EZH8

A0A127EZH8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A127EZH8
DOMAINtad21/196PVDILFRSIAIVRRHYKLCAVVPAVFLVLAVVYLTVTPAQFTATTVMAIDPRKSATATPG
ASSQNQDIPVDNLTVESQTEILQSENISLKVIRDLKLLDDPDFNQRSAIGAVFGWLISWV
HSSPPPTDLERERAVVEQFAKRLSVKRIGVTFMFEIGFTLPDKEKAAVVANAVANA
DOMAINcd545/731ISALPGEGKSTISANFAALVACSGASAILVDGDLRSSMLSGRLTPGAQKGLLDLLSGRQA
EGSLVRLDHLRCDFIPSVHGSAAANPNQWISSVAMRSLLEKLKARYDYVIVDLPPLVPVT
DAHAAADLFDCFVMVVEWGATSAEIVQSGFHGSSRITTKTVGAVLNKVHPTASAYYGNMR
YATVTYS
SITEWalker A552/554GKS
SITEWalker A'572/579ILVDGDLR
SITEWalker B653/659VIVDLPP
SITE-650/-652YDY
SITEY Cluster719/730YYGNMRYATVTY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLQTSNISLGEPLSSPHLLSPVDILFRSIAIVRRHYKLCAVVPAVFLVLAVVYLTVTPAQFTATTVMAIDPRKSATATPG
                    PVDILFRSIAIVRRHYKLCAVVPAVFLVLAVVYLTVTPAQFTATTVMAIDPRKSATATPG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASSQNQDIPVDNLTVESQTEILQSENISLKVIRDLKLLDDPDFNQRSAIGAVFGWLISWVHSSPPPTDLERERAVVEQFA
ASSQNQDIPVDNLTVESQTEILQSENISLKVIRDLKLLDDPDFNQRSAIGAVFGWLISWVHSSPPPTDLERERAVVEQFA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KRLSVKRIGVTFMFEIGFTLPDKEKAAVVANAVANAYVDDQLQAKYEVAARAGNWLQDRLKELGKQTSAAERAVVDFRIK
KRLSVKRIGVTFMFEIGFTLPDKEKAAVVANAVANA                                            

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NNIVDTGGRLMSEQQLAELNSQLALASASASEASAKLSRIQEIMASDVPDANVTDALHNEVIVKLRNQYTDLQKREAYLV


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DKLGPAHQAVLQVRADMRTAVRSIRQELQRIAAGYQSDFEIGRSRVDSIQKSLADLVSKANTTNQAQIELKALDSTAQSY


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RTLYDTFLQRYMESVQQKSFPLTEARVITKATPPLKKSKPKTLITLIIALIGGSAVGFAAAWVREIFDRTLRTSDEVRAA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGVPCISTVPMLDPGSRPNPVFTGMSHLGEVVARPMSRFAESMRAIKVAVDFFPADRKPQVIGFISALPGEGKSTISANF
                                                                ISALPGEGKSTISANF
                                                                       GKS      
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AALVACSGASAILVDGDLRSSMLSGRLTPGAQKGLLDLLSGRQAEGSLVRLDHLRCDFIPSVHGSAAANPNQWISSVAMR
AALVACSGASAILVDGDLRSSMLSGRLTPGAQKGLLDLLSGRQAEGSLVRLDHLRCDFIPSVHGSAAANPNQWISSVAMR
           ILVDGDLR                                                             
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLLEKLKARYDYVIVDLPPLVPVTDAHAAADLFDCFVMVVEWGATSAEIVQSGFHGSSRITTKTVGAVLNKVHPTASAYY
SLLEKLKARYDYVIVDLPPLVPVTDAHAAADLFDCFVMVVEWGATSAEIVQSGFHGSSRITTKTVGAVLNKVHPTASAYY
            VIVDLPP                                                           YY
       730 
....:....|.
GNMRYATVTYS
GNMRYATVTYS
GNMRYATVTY 

© 1998-2019